SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000045301 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000045301
Domain Number 1 Region: 155-211
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000105
Family Classic zinc finger, C2H2 0.0082
Further Details:      
 
Domain Number 2 Region: 117-168
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000173
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 3 Region: 930-981
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000134
Family Classic zinc finger, C2H2 0.018
Further Details:      
 
Domain Number 4 Region: 634-686
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000187
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 5 Region: 807-832,881-906
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000189
Family Classic zinc finger, C2H2 0.034
Further Details:      
 
Domain Number 6 Region: 282-332
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000862
Family Classic zinc finger, C2H2 0.032
Further Details:      
 
Domain Number 7 Region: 781-819
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000349
Family Classic zinc finger, C2H2 0.02
Further Details:      
 
Domain Number 8 Region: 693-741
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000845
Family Classic zinc finger, C2H2 0.028
Further Details:      
 
Domain Number 9 Region: 1255-1306
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000159
Family Classic zinc finger, C2H2 0.027
Further Details:      
 
Domain Number 10 Region: 1193-1247
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000217
Family Classic zinc finger, C2H2 0.03
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000045301
Domain Number - Region: 476-533
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000108
Family Classic zinc finger, C2H2 0.045
Further Details:      
 
Domain Number - Region: 1134-1159
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00243
Family Classic zinc finger, C2H2 0.036
Further Details:      
 
Domain Number - Region: 722-775
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00863
Family Classic zinc finger, C2H2 0.026
Further Details:      
 
Domain Number - Region: 405-457
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0426
Family Classic zinc finger, C2H2 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000045301   Gene: ENSBTAG00000007383   Transcript: ENSBTAT00000048222
Sequence length 1311
Comment pep:known chromosome:UMD3.1:24:31675533:32049400:1 gene:ENSBTAG00000007383 transcript:ENSBTAT00000048222 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRRKQAKPRSLKDPNCKLEDKTEDGEAIDCKKRPEDGEELEDEAVHSCDSCLQVFESLS
DITEHKINQCQLTDGVDVEDDPTCSWPASSPSSKDQTSPSHGEGCDFGEEEGGPGLPYPC
QFCDKSFSRLSYLKHHEQSHSDKLPFKCTYCSRLFKHKRSRDRHIKLHTGDKKYHCSECD
AAFSRSDHLKIHLKTHTSNKPYKCAICRRGFLSSSSLHGHMQVHERNKDGSQSGSRMEDW
KMKDTQKCSQCEEGFDFPEDLQKHIAECHPECSPNEDRAALQCVYCHELFVEETSLMNHM
EQMHGGEKKNSCSICSESFHSVEELYSHMDGHQQPESCNHSNSPSLVTVGYTSVSSTTPD
SNLSVDSSTMVEAAPPIPKSRGRKRAAQQTPDMTVPSSKQAKVTYSCIYCNKQLFSSLAV
LQIHLKTMHLDKPEQAHICQYCLEVLPSLYNLNEHLKQVHEAQDPGLIVSALPAIVYQCN
FCSEVVNDLNTLQEHIRCSHGFANPAAKDSNAFFCPHCYMGFLTDSSLEEHIRQVHCDLS
GSRFGSPVLGTPKEPVVEVYSCSYCTNSPIFNSVLKLNKHIKENHKNIPLALNYIHNGKK
SRALSPLSPVAIEQTSLKMMQAVGGAPARQAGEYICNQCGAKYTSLDGFQTHLKTHLDTV
LPKLTCPQCNKEFPNQESLLKHVTIHFMITSTYYICESCDKQFTSVDDLQKHLLDMHTFV
FFRCTLCQEVFDSKVSIQLHLAVKHSNEKKVYRCTSCNWDFRNETDLQLHVKHNHLENQG
KVHKCIFCGESFGTEVELQCHITTHSKKYNCQFCSKAFHAIILLEKHLREKHCVFDTKTP
NCGANGASEPGQKEEVELQTLLTNSQESHNSHDGSEEDVDTSEPMYGCDICGAAYTMETL
LQNHQLRDHNIRPGESAIVKKKAELIKGNYKCNVCSRTFFSENGLREHMQTHLGPVKHYM
CPICGERFPSLLTLTEHKVTHSKSLDTGNCRICKMPLQSEEEFLEHCQMHPDLRNSLTGF
RCVVCMQTVTSTLELKIHGTFHMQKTGNGATVQATGRGPHVPKLYKCASCLKEFRSKQDL
VKLDINGLPYGLCAGCVNLSKSASPGVNIAPGSSRPGLGQTENLGAVEGKGKASAPKTRC
SSCNVKFESESELQNHIQTVHRELVPDSNSTQLKTPQVSPMPRISPSQSDEKKTYQCIKC
QMVFYNEWDIQVHVANHMIDEGLNHECKLCSQTFDSPAKLQCHLIEHSFEGMGGTFKCPV
CFTVFVQANKLQQHIFSAHGQEDKIYDCTQCPQKFFFQTELQNHTMTQHSS
Download sequence
Identical sequences F1N5E2
XP_005224127.1.76553 XP_010817063.1.76553 ENSBTAP00000045301 ENSBTAP00000045301 9913.ENSBTAP00000045301

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]