SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000045902 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000045902
Domain Number 1 Region: 25-142
Classification Level Classification E-value
Superfamily SNARE-like 1.14e-26
Family Clathrin coat assembly domain 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000045902   Gene: ENSBTAG00000034555   Transcript: ENSBTAT00000048949
Sequence length 159
Comment pep:known chromosome:UMD3.1:24:51182584:51183438:-1 gene:ENSBTAG00000034555 transcript:ENSBTAT00000048949 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KILVRHRRYNREAVTKIQKSQSEDIQQQIIGETFHLVSKRDENICNFLEGGLLIGGSENK
LIYRHYATLYFVFCVDSSESELDVLDLIQVFVETLDKCFENICELDLTFHVDKIHNILAE
MVMGMVLETNMNEIVTQIDVKSRGKKSSKFTMQLFTKNR
Download sequence
Identical sequences F1N380
ENSBTAP00000045902 ENSBTAP00000045902

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]