SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000045919 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000045919
Domain Number 1 Region: 397-449
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000318
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 2 Region: 241-298
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000632
Family Classic zinc finger, C2H2 0.021
Further Details:      
 
Domain Number 3 Region: 203-255
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000168
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 4 Region: 283-335
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000569
Family Classic zinc finger, C2H2 0.034
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000045919
Domain Number - Region: 429-482
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000268
Family Classic zinc finger, C2H2 0.031
Further Details:      
 
Domain Number - Region: 372-412
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00129
Family Classic zinc finger, C2H2 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000045919   Gene: ENSBTAG00000037393   Transcript: ENSBTAT00000048967
Sequence length 485
Comment pep:known chromosome:UMD3.1:1:88405655:88410920:-1 gene:ENSBTAG00000037393 transcript:ENSBTAT00000048967 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNEYPKKRKRKTLHPSRYSDSSGISRIADGFNGIFSDHCYSVCSMRQPDLKYFDNKDDDS
DTETSNELPKFTDGIKARNRNQNYLVPSPVLRILDHTAFPTEKSADIEICDEDCDSPESV
HQQTQEESPIEVHTAEDVPIAAEVHAISEDYDIETENNSSESLQDQTDEEPPAKLCKIVD
KSQALNVTAQQKWPLLRANSSGLYKCELCEFNSKYFSDLKQHMILKHKRTDSNVCRVCKE
SFSTNMLLIEHAKLHEEDPYICKYCDYKTVIFENLSQHIADTHFSDHLYWCEQCDVQFSS
SSELYLHFQEHSCDEQYLCQFCEHETNDPEDLHSHVVNEHACKLIELSDKYNNGEHGQYS
LLSKITFDKCKNFFVCQVCGFRSRLHTNVNRHVAIEHTKIFPHVCDDCGKGFSSMLEYCK
HLNSHLSEGIYLCQYCEYSTGQIEDLKIHLDFKHSADLPHKCSDCLMRFGNERELISHLP
VHETT
Download sequence
Identical sequences A5PK30
NP_001092493.1.59421 NP_001092493.1.76553 XP_010799645.1.76553 XP_010799646.1.76553 ENSBTAP00000045919 9913.ENSBTAP00000045919 ENSBTAP00000045919

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]