SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000046130 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000046130
Domain Number 1 Region: 29-135
Classification Level Classification E-value
Superfamily SET domain 0.000085
Family Histone lysine methyltransferases 0.042
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000046130
Domain Number - Region: 154-182
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00245
Family Classic zinc finger, C2H2 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000046130   Gene: ENSBTAG00000020570   Transcript: ENSBTAT00000049199
Sequence length 337
Comment pep:known chromosome:UMD3.1:6:96650285:96657180:1 gene:ENSBTAG00000020570 transcript:ENSBTAT00000049199 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDSGIQRGIWEGDAKAVQQCLTDIFTSVYTTCDIPENAIFGPCVLSHTSLYDSIAFIAL
KSTDKRTVPYIFRVDTSAANGSSEGLMWLRLVQSARDKEEQNLEAYIKNGQLFYRSLRRI
AKDEELLVWYGKELTELLLLCPSRSHSKMNAGSSPYTCLECSQRFQFEFPYVAHLRFRCP
KRLHGADLSPREEQGGSVGTKDHGGGGGGGKDQQQSQEAPLGPGPKFCKAGPVHHYPAPS
PESGGGCGAPAVAAAVGAHAAAALVHLAVSARAELVRQVQCLLPHDLRPSVPHEVASQKG
VRHGALGEAEAGGETQVPHLQRVLQGAPPPLQAYDLA
Download sequence
Identical sequences A7E331
ENSBTAP00000046130 NP_001096702.1.59421 NP_001096702.1.76553 ENSBTAP00000046130 9913.ENSBTAP00000046130

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]