SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000046145 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000046145
Domain Number 1 Region: 373-422
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000386
Family Classic zinc finger, C2H2 0.045
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000046145
Domain Number - Region: 425-477
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00119
Family Classic zinc finger, C2H2 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000046145   Gene: ENSBTAG00000034761   Transcript: ENSBTAT00000049218
Sequence length 542
Comment pep:known chromosome:UMD3.1:17:51645903:51648371:-1 gene:ENSBTAG00000034761 transcript:ENSBTAT00000049218 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPPWMSCEEEQEPEPQKSEGETKLVNDEDAELILVGVEHVHEDDDVIFVGMTSNSKPVI
SNILNRVTPGSCSRRNRYGHFRKDNAQKLQPVSHVTPTSEAKTVLPLSVSESRSTDSPII
IEPLSKADSKNISPQIMPNSFSELCSPLITFTSSLQHPVETAVSAGDMDKSPRVSKRLST
SETNSTSPKRPTLSDGVIGEHSLALSLSGTFHTVTTQQSTPDSVHNSLSHVQSGEPCPTA
YCHDLLICGCISVALGNFTTKQDSLTLSLRNKHGAETHLKVINLPKKMQLVLIFFDSKVH
VSKHCTITCSHRIRVFITTIEFWKHWDLWSHPPRTKKYLKYGTTIQHCHRQFYAFQLQCH
IESVHTSQEPCTVCKICELSFEADQILLQHMKDNHKPGEMPYVCQVCSYRSSFFADVDAH
FRAYHGNTKNLLCPFCLQIFKTEALYICHYRQHWAKRFHQCSKCRLQFLTCKEKREHKTQ
CHQMFKKPKQLEGLPPERKVVIQVSLEPLQPGLVEVASITVNASDSEPSPPKSKSRRSKK
PS
Download sequence
Identical sequences G5E607
ENSBTAP00000046145 ENSBTAP00000046145

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]