SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000046441 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000046441
Domain Number 1 Region: 1-78
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 0.0000000000000183
Family Frizzled cysteine-rich domain 0.00058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000046441   Gene: ENSBTAG00000006621   Transcript: ENSBTAT00000049563
Sequence length 427
Comment pep:known chromosome:UMD3.1:21:1492040:1508578:1 gene:ENSBTAG00000006621 transcript:ENSBTAT00000049563 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FRPVVNLDCSRGFRPSPCALCAPICVEYSRVTPPCHRFCQRAHSECLKLMELFGVAWPED
MECSSQFPVWSTGEKCIICGSSTGVSSRGCPGGLGFAPVRASPRPGIAAQSLTPAPSCWA
FQGTCVPVRELKIDPDLGCCFLHMRDCSPPCPNMYFRREELSFARYFIGLISVICLSATL
FTFLTFLIYVIRFQYSERTVRIYAVCYMMVLLIFFIGFLLEDRVACNSSSPAQYKASTVT
QGSHNKTCIMLLMILYFFMAGSIWWVILTIMWFLAAVPKSGSEAIGKEALLFHASVWGVP
GTLTIILLAMNKIEGDSISGVCFVGLYDVDALRYFVLAPLCLYVVFGVSLLLAGIISLNR
VRVEIPLQKVNQDKLVKFMIWIGVFSTLYLVPLMVVIGCYFYEQAYRGIWETTWIQERCR
AYHIPCP
Download sequence
Identical sequences F1MMN8
ENSBTAP00000046441 ENSBTAP00000046441

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]