SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000046605 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000046605
Domain Number 1 Region: 526-582
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.73e-21
Family Classic zinc finger, C2H2 0.0091
Further Details:      
 
Domain Number 2 Region: 469-526
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.03e-18
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 3 Region: 356-413
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000551
Family Classic zinc finger, C2H2 0.0096
Further Details:      
 
Domain Number 4 Region: 413-470
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000631
Family Classic zinc finger, C2H2 0.023
Further Details:      
 
Domain Number 5 Region: 567-620
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000088
Family Classic zinc finger, C2H2 0.028
Further Details:      
 
Domain Number 6 Region: 319-370
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000145
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 7 Region: 242-302
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000613
Family Classic zinc finger, C2H2 0.034
Further Details:      
 
Domain Number 8 Region: 167-218
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000025
Family Classic zinc finger, C2H2 0.026
Further Details:      
 
Domain Number 9 Region: 4-131
Classification Level Classification E-value
Superfamily SET domain 0.00000867
Family Histone lysine methyltransferases 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000046605   Gene: ENSBTAG00000012111   Transcript: ENSBTAT00000049757
Sequence length 630
Comment pep:known chromosome:UMD3.1:6:4491175:4743136:1 gene:ENSBTAG00000012111 transcript:ENSBTAT00000049757 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLGMYVPDRFSLKSSRVQDGMGLYTARRVRKGEKFGPFAGEKRMPEDLDENMDYRLMWEV
RGSKGEVLYILDATNPRHSNWLRFVHEAPSQEQKNLAAIQEGENIFYLAIEDIETDTELL
IGYLDSDMEADEEEQQIMTMINEEEGKNSKGQSTASRKDRFGCKEDYACPYCESSFTSEE
ILAEHLQTLHQKPTEEKEYKCKSCGKKFPVKQALQRHVLQCSAKSSLKDSSRSFQCSVCN
TSFSSASSFEQHQETCQGDARFVCKADSCGKRLKSKEALRRHQENVHTGDPKKKLICSVC
NKKCSSASSLQEHRKIHEIFDCQECMKKFISANQLKRHMITHSEKRPYNCEICNKSFKRL
DQVGAHKVIHSEDKPYKCKLCGKGFAHRNVYKNHKKTHSEERPFQCEECKALFRTPFSLQ
RHLLIHNSERTFKCHHCDATFKRKDTLNVHVQVVHERHKKYRCELCNKAFVTPSVLRSHK
KTHTGEKEKICPYCGQKFASSGTLRVHIRSHTGERPYQCPYCEKGFSKNDGLKMHIRTHT
REKPYKCSECGKAFSQKRGLDEHTRTHTGEKPFQCDVCDLAFSLKKMLIRHKMTHNPNRP
LAECQFCHKKFTRNDYLKVHMDNIHGEADS
Download sequence
Identical sequences F1MFG2
ENSBTAP00000046605 ENSBTAP00000046605

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]