SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000046669 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000046669
Domain Number 1 Region: 383-439
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.92e-26
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 2 Region: 327-383
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.35e-25
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 3 Region: 438-495
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.79e-23
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 4 Region: 270-327
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.53e-22
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 5 Region: 9-71
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.18e-21
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 6 Region: 484-536
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.6e-19
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 7 Region: 222-271
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000133
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 8 Region: 175-216
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000429
Family Classic zinc finger, C2H2 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000046669   Gene: ENSBTAG00000012353   Transcript: ENSBTAT00000049839
Sequence length 543
Comment pep:known chromosome:UMD3.1:14:1491984:1497904:-1 gene:ENSBTAG00000012353 transcript:ENSBTAT00000049839 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAALDLCALPQAEVTFEDVAVFLSQEEWGLLGPAQKGLYREVMLETYRNLVSLGAGLAGP
KPEVIAQLEQGDELWVLDMHGAEQPSVDGSAHGTRTENQEVTSGEMLFGRELDPLRGSVL
RGPEPGEVHERVREPEGRLDRPGEQRGPRLVTLANEECGLESGGNLRSRSRPVPDQRPHK
CDICEQSFEQRSYLNNHKHVHRCKKTNIVHDSGEIFAANLVKEDQKIPVGKRLYYCGCCG
KAFRYSANLVKHQRLHSEEKPYKCEECGKAFHQSCELISHRRMHSGEIPYRCDECGKTFN
QRPNLMKHQRIHTGEKPYKCSECGKHFSAYSSLIYHQRIHTGEKPYKCSDCGKAFSDGSI
LIRHRRTHTGEKPYECKECGKGFTQSSNLIQHQRIHTGEKPYKCNECEKAFIQKTKLVEH
QRSHTGEKPYECNDCGKVFSQSTHLIQHQRIHTGEKPYKCSECGKAFHNSSRLIHHQRSH
HGEKPYKCADCKKAFSQGTYLLQHRRIHTGEKPYTCGECGKAFRHSSNMSQHQRIHLRED
FSL
Download sequence
Identical sequences G3X805
ENSBTAP00000046669 XP_015329850.1.76553 ENSBTAP00000046669

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]