SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000046848 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000046848
Domain Number 1 Region: 298-349
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000919
Family Classic zinc finger, C2H2 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000046848   Gene: ENSBTAG00000035606   Transcript: ENSBTAT00000050094
Sequence length 466
Comment pep:known chromosome:UMD3.1:17:36034532:36037275:-1 gene:ENSBTAG00000035606 transcript:ENSBTAT00000050094 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SKKKKYGHFRKGNAQKLQPVSHVTPTSEAKSVLPVSVSESRSTDSPIIIEPLSKVDYKNI
SPQLVPNSFSELCSPLITFTSSLQHLVETAVSAGDMDKSPHVSKRLSTSETNSTNPQRPK
LSDGTIGEHSLALFPSDSDYQQSTPNSVHTSLSHVQNGEPCPTAFPKDDVHCKPISPLRE
NGLTKMDFPTIASQNKIVDPTEGNLIVLLHDFYSGQHIGDGQPEPKTHTAFKWLSCLKVL
KNFKFMNHMKHHLELERQRGDSWKYHTTCQHCHSQFATPFQLQFHIESVHNSQKPSTVCK
ICDLSFETEQVLLQHMKDNHKPGEMPCVCKVCSYRSSFFADVDAHFRTHHGNTKNLLCLF
CLKIFKTATPYMRHYRWHEKSFHQCSKCRLQFLTFKEIREHKTQCHQMFKKPKQLEGLLP
EAKVVIQVSLEPLQPGLLKVASITVNTSNSEPPPPKSKSRNSKAQL
Download sequence
Identical sequences G3X813
ENSBTAP00000046848 ENSBTAP00000046848

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]