SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000047002 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000047002
Domain Number 1 Region: 672-728
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.72e-23
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 2 Region: 428-485
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.84e-20
Family Classic zinc finger, C2H2 0.0099
Further Details:      
 
Domain Number 3 Region: 713-765
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.89e-19
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 4 Region: 470-522
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000184
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 5 Region: 513-570
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000874
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 6 Region: 390-442
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000386
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 7 Region: 243-298
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000136
Family Classic zinc finger, C2H2 0.058
Further Details:      
 
Domain Number 8 Region: 288-338
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000916
Family Classic zinc finger, C2H2 0.039
Further Details:      
 
Domain Number 9 Region: 555-610
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000147
Family Classic zinc finger, C2H2 0.055
Further Details:      
 
Domain Number 10 Region: 51-73,134-161
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000917
Family Classic zinc finger, C2H2 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000047002   Gene: ENSBTAG00000021789   Transcript: ENSBTAT00000031986
Sequence length 821
Comment pep:known chromosome:UMD3.1:18:51504690:51507155:1 gene:ENSBTAG00000021789 transcript:ENSBTAT00000031986 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XQCLECGQLLMSPSQLLEHQELHLKMMAPQEAVPAEPPPKAPALSSSTIHYECVDCKALF
ASQELWLNHRQTHLRATPTKPPTPVVLGSPVVVGSPVGQTRVAVEHSYRKAEEGGEGAAV
PSAAATTTEVVTEVELLLYKCSECSQLFQLPADFLEHQATHFPAPAPESEEPVLQQETLT
PAPVEVPVSQPEPVPSSDHSYELRNGEALGRDRRGRRARRNNSGEPGGAATQELFCSACD
QLFLSPHQLQQHLRSHREGVFKCPLCSRVFPSPSSLDQHLGDHSSESHFLCVDCGLAFGT
EALLLAHRRAHTPNPLHSCPCGKTFVNLTKFLYHRRTHGVGGVPLPTTPVPPEEPVLGFP
EPAPAETGEPEAPEPPVAEESSAEPAAPGTYRCLLCSREFGKALQLTRHQRFVHRLERRH
KCSICGKMFKKKSHVRNHLRTHTGERPFPCPDCSKPFNSPANLARHRLTHTGERPYRCGD
CGKAFTQSSTLRQHRLVHAQHFPYRCQECGVRFHRPYRLLMHRYHHTGEYPYKCRECPRS
FLLRRLLEVHQLVAHAGRQPHRCSSCGAAFPSSLRLREHRCAAAAAQAPRRFECGTCGKK
VGSAARLQAHEAAHAAAGPGEVLAKEPPAPRAPRAARTPITSPTTLGSAAPAAPAAPARR
RGLECSECKKLFSTETSLQVHRRIHTGERPYPCPDCGKAFRQSTHLKDHRRLHTGERPFA
CEVCGKAFAISMRLAEHRRIHTGERPYSCPDCGKSYRSFSNLWKHRKTHQQQHQAAVRQQ
LAEAEAAVGLAVMETAVEALPLVEAIEIYPLAEAEGVQISG
Download sequence
Identical sequences G5E624
ENSBTAP00000047002 ENSBTAP00000047002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]