SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000047534 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000047534
Domain Number 1 Region: 263-320
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.98e-26
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 2 Region: 347-404
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.75e-26
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 3 Region: 2-63
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 5.75e-25
Family KRAB domain (Kruppel-associated box) 0.00093
Further Details:      
 
Domain Number 4 Region: 179-236
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.96e-23
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 5 Region: 393-445
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.17e-18
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 6 Region: 102-149
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000577
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 7 Region: 310-342
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000973
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 8 Region: 226-258
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000755
Family Classic zinc finger, C2H2 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000047534   Gene: ENSBTAG00000038178   Transcript: ENSBTAT00000052912
Sequence length 453
Comment pep:known chromosome:UMD3.1:28:13138755:13142845:1 gene:ENSBTAG00000038178 transcript:ENSBTAT00000052912 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NMLFQGPVTFKDVTVEFTREEWKLLDTAQRTLYREVMQENYSHLISVGYCANRPNAIFKL
KQGKEPWILEVQFPRQNNPEDLCNTHDQGARCPESQAENSRNGELKKHQKTHTNEKTYKC
NECGKAFYQKSILIIHEHTHSKDKPGECEKSVSQNGDLTRQPKTPTREKTYECKECKKTF
YHLSSLSRHLRTHAGEKPYECNQCEKSFYQKPHLMEHQKTHTGEKPFECTECGKFFYVKA
YLMVHQKTHTGEKPYECKECRKSFSQKSHLTVHQRTHTGEKPYKCKECGKFFSRNSHLKT
HQRTHTGEKPYECKECGKCFYQKSALTVHQRTHTGEKPFECNKCGKTFYYKSDLTKHQRK
HTGEKPYECNECGKSFSVNSVLRLHQRTHTGEKPYECKECGKSFSQKSHFVIHQRKHTGE
KPYECKECKETFFQKSKLTAHQKTHTEAYMVET
Download sequence
Identical sequences F1N0G9
ENSBTAP00000047534 ENSBTAP00000047534

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]