SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000047583 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000047583
Domain Number 1 Region: 571-634
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000598
Family Complement control module/SCR domain 0.0023
Further Details:      
 
Domain Number 2 Region: 499-545
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000144
Family TSP-1 type 1 repeat 0.00063
Further Details:      
 
Domain Number 3 Region: 626-682
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000195
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 4 Region: 26-73
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000785
Family TSP-1 type 1 repeat 0.002
Further Details:      
 
Domain Number 5 Region: 79-119
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000736
Family LDL receptor-like module 0.0014
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000047583
Domain Number - Region: 451-489
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00132
Family EGF-type module 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000047583   Gene: ENSBTAG00000011766   Transcript: ENSBTAT00000056663
Sequence length 843
Comment pep:known chromosome:UMD3.1:20:33549495:33606517:-1 gene:ENSBTAG00000011766 transcript:ENSBTAT00000056663 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKAITLLFLVGFIGEFQVFSSASSPINCQWGSYAPWSECNGCTKTQTRRRSIAVYGQYGG
HSCVGSAFETQPCQPTRGCPTEDGCGERFRCFSGQCISKSLVCNGDSDCEEDGADEDRCE
DAESRPACDKDKPPPNIELTGRGYNALTGQFRNQVLNTKSFGGQCRKVYSGDGRDFYRLS
GNILSYTFQVKINNDFNNEFYNSTWAYVKETSTEHSSSSKGRFLFFSSSSSSHGYSSNTN
ILTKKKSYQLLVLQNTVEVAQFINNNPEFLQLAESFWKELSYLPSLYDYSAYRRLIDQYG
THYLQSGSLGGEYKVIFHMDSEKVKKFDFHSEDKRKCASSHFQFLFTSSKQKCTTMEEVL
KSVSENEGNLLRGVPFVRGGHSGFLAGLSYLDLNNPAGNKRRYSQWAGSVPDLPEVIKQK
LTPLYELVKEVPCASVKKLYLKRAIEEYLDEFDPCHCRPCHNGGMATVQGSQCQCYCKPK
TSGVACEQGVLLGDQAGGVDGGWNCWSSWGPCVQGKKTRSRQCNNPSPSAGGKSCIGETS
ETRQCEDGELEHLRLLEPHCFPLSLVPTKFCSSPPALKDGFVQDEGATFPVGKNIMYTCK
EGYSLVGDPVARCGEDLQWLVGNMHCQKIACVLPALMDGIQSHPHKPFYTIGEKVTISCS
GGRSLEGPSTFLCSSSLKWSPEVKDVQCVQREAPLTPKVPKCQPWEKLQNSRCVCKMPYE
CGSSLGVCARDERSKRILPLTVCKMHVLQCQGRNYTVAGRESCTLPASAEKACGVCPLWE
KCDAEGSECVCRAASECEEAGFSVCVEVNGREQTMTECEAGVLRCRGLSISVTGIRPCAA
EAA
Download sequence
Identical sequences F1N045
ENSBTAP00000047583 9913.ENSBTAP00000047583 ENSBTAP00000047583

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]