SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000047611 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000047611
Domain Number 1 Region: 39-96
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.6e-18
Family Classic zinc finger, C2H2 0.0084
Further Details:      
 
Domain Number 2 Region: 154-210
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.73e-17
Family Classic zinc finger, C2H2 0.0085
Further Details:      
 
Domain Number 3 Region: 81-133
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.62e-16
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 4 Region: 210-266
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000344
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 5 Region: 421-471
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000115
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 6 Region: 314-364
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000175
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 7 Region: 251-303
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000359
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 8 Region: 462-507
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000539
Family Classic zinc finger, C2H2 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000047611   Gene: ENSBTAG00000030403   Transcript: ENSBTAT00000055556
Sequence length 529
Comment pep:known chromosome:UMD3.1:18:62393201:62408437:1 gene:ENSBTAG00000030403 transcript:ENSBTAT00000055556 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDDAPLPAPPLPARAPAPGPAPPAAAPRVPFHCSECGKSFRYRSDLRRHFARHTALKPHA
CPRCGKGFKHSFNLANHLRSHTGERPYRCSACPKGFRDSTGLLHHQVVHTGEKPYCCLVC
ELRFSSRSSLGRHLKRQHRRGKKIFGCSECEKLFRSPRDLERHVLVHTGEKPFPCLECGK
FFRHECYLKRHRLLHGAERPFPCHVCGKGFITLSNLSRHLKLHRARAPLPCPTCGRLFRF
PYYLSRHRLSHSGLRPHACPLCPKAFRRPAHLSRHLRGHGPQPPLRCAACPRTFPEPAQL
RRHLAQEHAGGGGHQCSICLKAFARPWSLSRHRLVHSTDRPFVCTDCGLAFRLASYLRQH
RRVHGALSLLAPLPAAAKKDDKAVAVSGRTSGRGPEGGEGAEGGPGGQNGGEAAPARAPA
GEPRFWCPECGKGFRRRAHLRQHGVTHSGARPFQCVRCQREFKRLADLARHAQVHAGGPA
PHPCPHCSRRFSRAYSLLRHQRCHRAELERAAAAQQAMQAPASPPRAPP
Download sequence
Identical sequences E1BKG6
ENSBTAP00000047611 ENSBTAP00000047611

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]