SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000047664 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000047664
Domain Number 1 Region: 380-436
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.11e-26
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 2 Region: 323-380
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.57e-24
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 3 Region: 4-64
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 9.29e-24
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 4 Region: 267-324
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.57e-23
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 5 Region: 211-268
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.38e-22
Family Classic zinc finger, C2H2 0.007
Further Details:      
 
Domain Number 6 Region: 436-492
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.2e-21
Family Classic zinc finger, C2H2 0.0061
Further Details:      
 
Domain Number 7 Region: 477-529
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.07e-19
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000047664   Gene: ENSBTAG00000038487   Transcript: ENSBTAT00000052047
Sequence length 641
Comment pep:known chromosome:UMD3.1:18:58130465:58141877:1 gene:ENSBTAG00000038487 transcript:ENSBTAT00000052047 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIKDQRSLTLEDVAVDFTWEEWQLLAPPQKALYRDVMLENYSNLVSVGYQASKPAALSRL
ERGELWPVEDKVHSRICPEMRKDDCLLQENLQNQSCPKRMERCHEHNALGNVYQSKNHCP
LWQNHDVLYLHGKTLKSNLSSISQNRNYEVKNPVKANVNGKFFLHAKHEEFHSESKLPEC
GIPMNTNSQIITCLGTQQINKPHVCTECGKAFIKKSRLIDHQRVHTGEKPHRCSVCGKAF
SRKSRLNEHQKTHIGEKQYACNECDKVFPKKSRLLIHQKTHTGEKPYICDDCGKGFVKKS
RLINHQRVHTGEKPHGCSLCDKAFSRKSRLMEHQRTHTGEKPYECTECDKAFRWKSQLNA
HQKTHTGEKSYICSDCGKGFIQKGNLIVHQRTHTGEKPYVCTECGKGFIQKGNLLIHQRT
HTGEKPYVCTECGKGFSQKTCLISHQRFHTGKTPFVCTECGKSCSHKSGLINHQRIHTGE
KPYTCNDCGKAFRDKSCLNRHRRIHTGERPYGCNDCGKAFSHLSCLVYHKGMLHAREKRG
DSVKLEDAFSKHLSPSHPSDMVQRKSPVSVVTVQMPSVAVQTPSHSNKPLEDKNIPLVGQ
LGGRYAPSAGNRIRTEEKPSECGSTLSGQLCHIFVTKDTQE
Download sequence
Identical sequences A4IFL9
9913.ENSBTAP00000047664 NP_001096807.1.59421 NP_001096807.1.76553 XP_010813606.1.76553 XP_010813607.1.76553 XP_010813608.1.76553 ENSBTAP00000047664 ENSBTAP00000047664

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]