SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000047717 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000047717
Domain Number 1 Region: 43-150
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 3.8e-27
Family Multidomain sulfurtransferase (rhodanese) 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000047717   Gene: ENSBTAG00000038931   Transcript: ENSBTAT00000054366
Sequence length 159
Comment pep:known chromosome:UMD3.1:9:50950780:50954323:-1 gene:ENSBTAG00000038931 transcript:ENSBTAT00000054366 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLQRLLPWSTCRTIFGSAEAVLWGLKSIKRSCLNFCTAICEGVTYKELKNLLKSKKIML
IDVREPWEIYESGKIPGSVNIPLDDVGEALQMNPKDFKEKYKEVKPSKSDSLVFSCLAGV
RSKVAMVTAISLGFNNAQHYAGGWKEWATYEISEKKQGN
Download sequence
Identical sequences A8R4B3
9913.ENSBTAP00000047717 NP_001103564.1.59421 NP_001103564.1.76553 XP_019822874.1.53367 ENSBTAP00000047717 ENSBTAP00000047717

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]