SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000047801 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000047801
Domain Number 1 Region: 4-63
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.75e-24
Family KRAB domain (Kruppel-associated box) 0.0015
Further Details:      
 
Domain Number 2 Region: 590-647
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.75e-23
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 3 Region: 334-391
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8e-23
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 4 Region: 446-503
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.32e-22
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 5 Region: 646-703
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.39e-22
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 6 Region: 758-815
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.13e-21
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 7 Region: 703-759
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.44e-21
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 8 Region: 390-447
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.76e-21
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 9 Region: 222-279
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.07e-21
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 10 Region: 278-335
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.63e-21
Family Classic zinc finger, C2H2 0.0077
Further Details:      
 
Domain Number 11 Region: 548-600
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.92e-19
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 12 Region: 800-852
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.8e-19
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 13 Region: 167-223
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.98e-19
Family Classic zinc finger, C2H2 0.0076
Further Details:      
 
Domain Number 14 Region: 488-540
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.42e-18
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000047801   Gene: ENSBTAG00000023464   Transcript: ENSBTAT00000053827
Sequence length 861
Comment pep:known chromosome:UMD3.1:18:47280908:47330516:1 gene:ENSBTAG00000023464 transcript:ENSBTAT00000053827 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRIGKESVMFSDVSIDFSLEEWEFLNLEQRDLYRDVMLENYSNLVSLGCFISKPDVISLL
EQGKEPWKVVRKGRRQYPVTSFRKRKTMCLLSCFLSDLETNYEIKKLSSENDIYEINLSQ
WKIMERIKNHGLKSFILKNDWESKRRFEGQEEYFNQVKITSQKMSPYQKRSSLSSRQRIH
YVEKPYECKECGKAFRVRQQLTFHHRIHTGEKPYECKECGMAFRQTAHLTRHQRLHSGEK
LYECKECGESFMCGPELRVHQKIHIGEKPYVCKECGKAFRVRGQLTLHQRIHTGEKPYVC
TECGKAFRQYAHLTRHQKLNIADKLYECKECGKAFLCGSGLRVHHKLHTGEKPYECKECG
KAFRVRQQLTLHQRIHTGEKPYECKECGKTFSRGYHLILHHRIHTGEKPYECKECWKAFS
RYSQLISHQSIHIGVKPYDCKECGKAFRLLSQLTQHQSIHIGEKPYKCKECGKAFRLRQK
LTLHQSIHTGEKPFECKECRKAFRLNSSLIQHLRIHSGEKPYECKECKKAFRQHSHLTHH
LKIHNRVHNGEKLYECKECRKTFIRRSTLSQHLRIHTGEKPYKCKECGQAFRQRAHLIRH
HKLHTGEKPYECKECGKAFTVLQELTQHQRLHTGEKPYECKECGKAFRVHQQLARHQRIH
TGEKPYECKACGKTFRQCTHLTRHQRLHTSEKLYECKECGKAFVCGPDLRIHQKIHFGEK
PYECKECGKAFRICQQLTVHQSIHTGEKPYECKDCGKTFRLRQQLVRHQRIHTREKPYEC
MECWKTFSSYSQLISHQSIHIGERPYECEECGKAFRLLSQLTQHQSIHTGEKPYECKECR
KPFRLLSQLTQHQSIHTGEKP
Download sequence
Identical sequences F1MVY4
ENSBTAP00000047801 ENSBTAP00000047801

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]