SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000047914 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000047914
Domain Number 1 Region: 40-88
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000021
Family Classic zinc finger, C2H2 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000047914   Gene: ENSBTAG00000039871   Transcript: ENSBTAT00000053721
Sequence length 580
Comment pep:known chromosome:UMD3.1:6:110339911:110342472:-1 gene:ENSBTAG00000039871 transcript:ENSBTAT00000053721 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HKFKVRNFKPGKYYCDKCRFSTKDPLQYKKHTLQHEEIKFVCSHCGCISYTKGEFQRHLV
KHTGVFPYRCEYCDYGAIRNDYIVKHRRRVHEKTGAKRPPKAIARLEPKRISASKQNPEL
SKTSSPRTAFQNKLSESKDYQKDVVCIPHKGALSEPTEVINLLENKSVEVEVLSPSKEPV
QPGMPLTVVAPAELVVPANCLAQLMDVKVVNGTQQLVLKLFPLEETNSLDAGGGDGGSSE
RGSKKKGYTYPHRAALPSIAFKGHSPLSLNDLGSRNEISLPAKTVTPPRKLQDNQTQEYK
DKPLELKNPDQTNDPFDGPVISSVFSLSSGSENVPEGVKWNSSTSKIKSRKASKVTSKST
PEGIQEINVSFTSAGYSTGTLPRPQDAGGISEQLAHQQAYPQLVEGSSGKTESRVTKKPH
VATPVLIPKGAVLRVLNSSEDSQIIEATCEAPVNITCTETQLIKPIPLCPMKRTDPDVQF
LTSESGPIDMSPNHDLSFRPKSRKESAHCSTMPKKPGSMHGPQVARQLRLIAAKPDQLIK
CPRRNQPVIVLNHPDVDSPEVSNVMKVINKYKGNVLKVVL
Download sequence
Identical sequences F1MWU2
ENSBTAP00000047914 ENSBTAP00000047914 9913.ENSBTAP00000047914

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]