SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000047971 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000047971
Domain Number 1 Region: 105-161
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.26e-19
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 2 Region: 48-105
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.32e-19
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 3 Region: 1-49
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000159
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 4 Region: 149-199
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000169
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000047971   Gene: ENSBTAG00000038613   Transcript: ENSBTAT00000054118
Sequence length 199
Comment pep:known chromosome:UMD3.1:25:39044611:39045856:1 gene:ENSBTAG00000038613 transcript:ENSBTAT00000054118 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KHQKMHTGEKPFKCNDMGKLTQQVSHTAKHHKIHSGLKPYECNECGKSFSMNLTLCPHQR
NHTGKKCHVCKVCGKAFSMKSSLTEHQRIHMAEKPYQCEECGNNFIQKSHLIEHQSTHTG
EKLHGCSKCVKSFCFKSALTMHQRTHTEEKAYKCSECEKPFKSYLTVHQITHTGKNPFKC
KCGKRFYVKSNLINHQRIH
Download sequence
Identical sequences F1MW80
ENSBTAP00000047971 ENSBTAP00000047971 9913.ENSBTAP00000047971

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]