SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000048176 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000048176
Domain Number 1 Region: 657-714
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.77e-25
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 2 Region: 601-658
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.81e-25
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 3 Region: 713-770
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.42e-25
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 4 Region: 545-602
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.73e-25
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 5 Region: 2-63
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.57e-22
Family KRAB domain (Kruppel-associated box) 0.00079
Further Details:      
 
Domain Number 6 Region: 350-407
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.67e-22
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 7 Region: 406-463
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.3e-22
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 8 Region: 294-351
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.85e-21
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 9 Region: 490-546
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3e-20
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 
Domain Number 10 Region: 769-823
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.4e-18
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 11 Region: 256-308
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.67e-18
Family Classic zinc finger, C2H2 0.0069
Further Details:      
 
Domain Number 12 Region: 453-485
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000145
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000048176   Gene: ENSBTAG00000011926   Transcript: ENSBTAT00000052670
Sequence length 841
Comment pep:known chromosome:UMD3.1:18:58994580:59004703:1 gene:ENSBTAG00000011926 transcript:ENSBTAT00000052670 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VVSFQELLTCEDVAIEFTQEEWEFLDPAQRALYREVMLETYRNLLSVGISVSDLNSISTL
EHEKKLWTVGSDVKIAKNTIAFSWIFLLISADISPTHVIKHLQLEVNSDKLETFQTLMLG
RPESCEIKHFHLWESEENMCDSECQGRDDKKNYKGTPVSLNGNVPNGRGSREIKDAGIKP
FGNRFGFNFQDKLQIFQTGRIISEYYEVERSVNNSFSFSPLQRIPPCVQTSVSNIYGNGY
MNPSVIMQELKIHKKKLYKCDGCDKAFRGKSILLSHQTVHTGEKLYKCDECGKAFTHSSQ
LRRHKKIHTGKKLFKCDICEKVFKRNAKFAGHQRVHTGEKPYKCDECGKAFRVKSYLLNH
QTVHIGEKPYKCDKCGKAFTHSSDLRRHKKIHTGKKLFKCDICDKVFGRNSNFAGHQIVH
TGEKPYKCDECGKAFCVKSKLLSHQTLHTGEKPYKCHECGEAFRVKSTLLSHQTVHTGEK
LYKCDECHEAFRVKSTLVRHQTVHTGEKFYKCECGKAFHVKSTLLSHQTLHTGEKPYKCD
ECGEAFRVKSTLLSHQTVHTGEKPYKCDECGKSFRVKSTLLSHQTVHTGEKPYECDECGK
AFRVKSKLLSHQTVHTGEKPYKCDECGKAFSVKSNLLNHQTVHTGEKPYKCDECGKAFPV
KSTLLRHQTIHTGEKPYKCDECGKAFRLKSYLLNHQTVHTGEKPYKCDECGKAFRVKSIL
LKHQTIHTGEKPYKCDECGKAFRVKSTLLSHQTIHSGEKPYKCDECGKAFRVKSILLKHQ
TIHTGENRYKCDACGKVFRKKPHLLLHWRIRTGERPFRCNECEVFKIQSSKFTPYCWSDN
S
Download sequence
Identical sequences F1MDP7
ENSBTAP00000048176 ENSBTAP00000048176

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]