SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000048361 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000048361
Domain Number 1 Region: 164-273,319-590
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 3.94e-149
Family Myotubularin-like phosphatases 0.0000000288
Further Details:      
 
Domain Number 2 Region: 52-143
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000289
Family Pleckstrin-homology domain (PH domain) 0.098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000048361   Gene: ENSBTAG00000001030   Transcript: ENSBTAT00000057477
Sequence length 1113
Comment pep:known chromosome:UMD3.1:17:71122533:71253675:1 gene:ENSBTAG00000001030 transcript:ENSBTAT00000057477 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDEETRHSLECIQANQIFPRKQLIREDENLQVPFLELHGESTEYVGRAEDAIIALSNYRL
HIKFKESLVNTASQSAASEIPIPLQLIESVECRDIFQLHLTCKDCKVIRCQFSTFEQCQE
WLKRLNNAIRPPAKIEDLFSFAYHAWCMEVYASEKEQHGDLCRPGEHVTSRFKNEVERMG
FDMNNAWRISNINEKYRLCGSYPQELIVPAWITDKELESVAGFRSWKRIPAVVYRHQSNG
AVIARCGQPEVSWWGWRNADDEHLVQSVAKACASDSRSGGSKPSARNSPRDFPCAGDLSD
VEFDSSLSNASGAESLAIQPQKLLILDARSYAAAVANRAKGGGCECPEYYPNCEVVFMGM
ANIHSIRRSFQSLRLLCTQMPDPGNWLSALESTKWLHHLSVLLKSALLVVHAVDRDQRPV
LAHCSDGWDRTPQIVALAKLLLDPYYRTIEGFQVLVEMEWLDFGHKFADRCGHGENSDDL
NERCPVFLQWLDCVHQLQRQFPCSFEFNEAFLVKLVQHTYSCLFGTFLCNNAKERGEKHT
QERTCSVWSLLRAGNKAFKNLLYSSQSEAVLYPVCHVRNLMLWSAVYLPCPSPSTPVDDS
CAPYPAPGCSPDDPPLSRLPKTRSFDNLTTACDNTVPLASRRSSDPSLNEKWQEHRRSLE
LSTLAGPGEEPVEPDSLGKPTKVLGGAELSVAAGVAEGQMENILQEATKEESGVEEPAHR
GVQEVKEEALLEEGSRGKSPEGSARELDQQPEVGEASLRSHPGTSLSGLSQGVPEQGGHS
VLPSSLQEPPREEGSQEVPMEPSQIGATAEDREEAVLPVSADVAVDSGTSQSSSLPSQVS
FETRGPNMDGSVDMLMEDKVKSDSGPQGHHRPGPVHSGWLGGKDVLPPAVEPRPAERPQL
GPVVHRTSPGSARSPAHSPSALPLAECKEGLVCNGAPETENKASEQPPGLSTLQKYPTPN
GHCANGETGRSKDSLSRQLSATSCSSAHVHTRSLHPKWLHGHSGRPSAAGSPEQPSRSHL
DDDGMPVYTDTIQQRLRQIESGHQQEVETLKKQVQELRSRLESQYLTSSLRFNGDFGDEV
VSTPWCLRSCTGDGHTVLGPFCPDFRDSRKGLE
Download sequence
Identical sequences F1MFT9
ENSBTAP00000048361 ENSBTAP00000048361

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]