SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000048363 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000048363
Domain Number 1 Region: 5-33
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000189
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000048363   Gene: ENSBTAG00000046308   Transcript: ENSBTAT00000055853
Sequence length 90
Comment pep:known chromosome:UMD3.1:4:67781717:68200912:-1 gene:ENSBTAG00000046308 transcript:ENSBTAT00000055853 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNLEQERPFVCSAPGCSQRFPTEDHLMIHRHKHEMTLKFPSIKTDNMLSDQTPTPTRFLK
NCEEVGLFSELDCSLEHEFRKAQEEESSKR
Download sequence
Identical sequences E1BED4
ENSBTAP00000048363 ENSBTAP00000048363

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]