SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000048405 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000048405
Domain Number 1 Region: 368-425
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.55e-24
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 2 Region: 200-257
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.58e-23
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 3 Region: 2-63
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 8.11e-23
Family KRAB domain (Kruppel-associated box) 0.0015
Further Details:      
 
Domain Number 4 Region: 256-313
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.76e-23
Family Classic zinc finger, C2H2 0.007
Further Details:      
 
Domain Number 5 Region: 312-369
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.7e-21
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 6 Region: 162-214
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.25e-20
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 7 Region: 410-459
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000528
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000048405   Gene: ENSBTAG00000040072   Transcript: ENSBTAT00000052977
Sequence length 460
Comment pep:known chromosome:UMD3.1:17:45107093:45116312:1 gene:ENSBTAG00000040072 transcript:ENSBTAT00000052977 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSFQESVTFRDVSIDFSREEWEWLQPAQRDLYRHVMLENYGHLVSLAGLNMSKPDVVSLL
EQGKEPWLGNGDVSRELFPASKSNGEIKEFSPKNVIFEDDSSQYLIMERFLSQGSEYSSF
KEGWKCEGDTEMLQGNQGCIRQVTASHQEALSQHVNVSAVERPYGCHECGKTFSRRFSLV
LHQRTHTGEKPYVCKECGKTFSQISNLVKHQMIHTGKKPHECKDCNKTFSYLSFLIEHQR
THTGEKPYECTECGKAFSRASNLTRHQRIHIGKKQYVCRKCGKAFSSGSELIRHQITHTG
EKPYECIECGKAFRRSSHLTRHQSVHTSKTPYECNECSKAFRCHSFLIKHQRIHAGEKLY
ECDECGKVFTWHASLAQHMKIHTGEKPYACTECDKTFSRSFSLILHQITHTGEKPYVCKV
CNKSFSWSSNLAKHERTHTLENPYEYENSFNYHSFLTEHQ
Download sequence
Identical sequences E1BCD4
ENSBTAP00000048405 9913.ENSBTAP00000048405 ENSBTAP00000048405

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]