SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000048518 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000048518
Domain Number 1 Region: 536-593
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.82e-25
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 2 Region: 480-537
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.84e-24
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 3 Region: 9-69
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 8.37e-24
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 4 Region: 424-481
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.09e-23
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 5 Region: 648-705
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.26e-22
Family Classic zinc finger, C2H2 0.0069
Further Details:      
 
Domain Number 6 Region: 312-369
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.12e-21
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 7 Region: 593-649
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.13e-21
Family Classic zinc finger, C2H2 0.007
Further Details:      
 
Domain Number 8 Region: 369-425
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.88e-20
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 9 Region: 270-322
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.82e-19
Family Classic zinc finger, C2H2 0.0082
Further Details:      
 
Domain Number 10 Region: 690-739
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.77e-16
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 11 Region: 222-270
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000236
Family Classic zinc finger, C2H2 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000048518   Gene: ENSBTAG00000025146   Transcript: ENSBTAT00000054299
Sequence length 754
Comment pep:known chromosome:UMD3.1:1:121430239:121435262:-1 gene:ENSBTAG00000025146 transcript:ENSBTAT00000054299 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVAECLRDCSQDSVTFTDVAVYFNQEEWTLLNPFQRKLYRNVMLENYKNLTTAGYQAIKP
TLISWLEQDVLKTVERGILQEWEMQLISNDLGIQQDILPEKTSNRVQMTQSHNGQELYDC
EHSWKDFSDSDYLYRSTQRRTENGGNSHEYSHYGKSFLILHNESFTGEKCSMFNQCGKAI
RLTPNTVYWQSSIQEKALEHRDCEQSFANGSYIHKKKRHDNWNECGRASIQSTSLQAHVP
THTANKHYIYEDSGKVSDATLSRRQHIKTHTVEKPFQCDTCGKAFGSSSYLRIHIRIHTG
IKPYKCKRCGKAFVSSSYLQVHSRIHTGIKPYKCKECGKDFSQSSNLTGHMKTHTRDQPY
KCKVCGKHFHRSSDLTGHTKTHTGEQLYKCKECGKAFGSSSHLRVHSQIHTGIKIYKCQE
CGKTFTGSSRLIEHMNTHTGEKPFKCDTCGKTFTQSSCLTKHMKIHTGEKPLKCDICGTT
FTQTSYLTQHMRTHTGEKPFKCDKCGKAFAAYSYLSNHFRTHTGEKPFKCDTCGKTFVQS
SGLSQHKKTHTGEKPFKCDTCGKTFSQSSYLSRHMRTHTGEKPYKCDTCGKGFGFSSILR
RHLQSHTGEKTAKCEKCGKTFTRASGLTQHMKTHTGEKPYKCDKCGKAFADSSCLTKHFR
THTGEKPFKCDKCGKSFAVSSRLTKHFRTHTGEKPFECNTCGKTFTTSLSVTMHKRRHTG
EKPYSCKICGKALGDYSCLNLNIFKINTGENPFE
Download sequence
Identical sequences F1N7M4
ENSBTAP00000048518 ENSBTAP00000048518

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]