SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000048532 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000048532
Domain Number 1 Region: 22-140
Classification Level Classification E-value
Superfamily POZ domain 2.46e-27
Family BTB/POZ domain 0.0022
Further Details:      
 
Domain Number 2 Region: 397-436
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000495
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000048532   Gene: ENSBTAG00000038888   Transcript: ENSBTAT00000054216
Sequence length 461
Comment pep:known chromosome:UMD3.1:23:7568876:7571700:1 gene:ENSBTAG00000038888 transcript:ENSBTAT00000054216 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTSTPLPPVAPSPACNPAPRTIQIEFPQHSSLLLEALNRHRLEGKFCDVSLLVQGRELR
AHKAVLAAASPYFHDKLLLGDAPRLTLPNVIEADAFEGLLQLIYSGHLRLPLDALPAHLL
VASGLQMWQVVDQCSEILRELENTGGGISSRGATPFHTLLSTTGGWCIRSSPFQTPAQSS
PSTQSPIGGEGSELGDVLQLQVEEEEEEDEEDQGSAAPSQTPQPQRESGSFPRPPVSHPL
PTSTTPCRLPEGESAPPEPPAPHTALPPKVFYIKQEPFESKEEIAGGGSQSVGAKEETKV
FPAGNTEENGELGFLLPSGAGTTSGGGGPSWKPVDLHGNEILSGGGGPGGAGQAVHGPVK
LGGAPPADGKRFGCLCGKRFAVKPKRDRHIMLTFSLRPFGCGICNKRFKLKHHLTEHMKT
HAGALHACPHCGRRFRVHACFLRHRDLCKGQGWATAHWTYK
Download sequence
Identical sequences F1N7I1
ENSBTAP00000048532 NP_001178391.1.59421 NP_001178391.1.76553 XP_019840795.1.53367 ENSBTAP00000048532

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]