SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000048542 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000048542
Domain Number 1 Region: 11-127
Classification Level Classification E-value
Superfamily POZ domain 9.03e-33
Family BTB/POZ domain 0.00026
Further Details:      
 
Domain Number 2 Region: 371-422
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.02e-18
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 3 Region: 407-459
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000027
Family Classic zinc finger, C2H2 0.0085
Further Details:      
 
Domain Number 4 Region: 114-174
Classification Level Classification E-value
Superfamily ARM repeat 0.00000978
Family GUN4-associated domain 0.092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000048542   Gene: ENSBTAG00000013306   Transcript: ENSBTAT00000053379
Sequence length 612
Comment pep:known chromosome:UMD3.1:24:48164179:48177831:-1 gene:ENSBTAG00000013306 transcript:ENSBTAT00000053379 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MANGIDELIGIPFPNHSSEVLCSLNEQRHDGLLCDVLLVVQEQEYRTHRSVLAACSKYFK
KLFTAGTLASQPYVYEIDFVQPEALAAILEFAYTSTLTITASNVKHILNAARMLEIQCIV
NVCLEIMEPGGDKEDDDDDEEDDDEDEEEEEEEEEEDDDDDTEDFADQENLPDPQDISCH
QSPSKSDHLSEKAYSDTPRDFPDSFQAGSPSHLGVIRDFSIESLLRELYPKASLPDRRPS
LSPFAPDFFPHLWPGDFGAFAQLPEQPMDSGPLDLVIKNRKIKEEEKEELPPPPPPPFPN
DFFKDMFPDLPGGPLGPIKAENDYGAYLNFLSATHLGGLFPPWPLVEERKLKPKASQQCP
ICHKVIMGAGKLPRHMRTHTGEKPYMCNICEVRFTRQDKLKIHMRKHTGERPYLCIHCNA
KFVHNYDLKNHMRIHTGVRPYQCEFCYKSFTRSDHLHRHIKRQSCRMARPRRGRKPAAWR
AASLLFGPGGPAPEKAAFVMPPALGDVGGHLGGAAVCLPGPSPAKHFLAAPKGALSLQEL
ERQFEETQMKLFGRAQLEAERNAGGLLAFALAENVAAARPYFPLPDPWAAGLAGLPGLAG
LNHVASMSEANN
Download sequence
Identical sequences E1BJM6
ENSBTAP00000048542 ENSBTAP00000048542

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]