SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000048591 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000048591
Domain Number 1 Region: 37-122
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 5.49e-29
Family SCAN domain 0.00045
Further Details:      
 
Domain Number 2 Region: 394-450
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.99e-19
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 3 Region: 358-407
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5e-16
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 4 Region: 435-487
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000163
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000048591   Gene: ENSBTAG00000040021   Transcript: ENSBTAT00000054362
Sequence length 497
Comment pep:known chromosome:UMD3.1:14:32532904:32536287:1 gene:ENSBTAG00000040021 transcript:ENSBTAT00000054362 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ESGNGVQYWDVGEMEDSPGAESLASVPPQDTLMENSDCDQETWHVRFRTFSSSEESDPVK
YLRRLRKLCHLWLRPDLHTKEQMMDRLVLEQFMICMPLECQVLLKESGVQSCKDLEDVLK
NKQKPKNWTIVCIQGQKYLVRDPDIEMFEAKASDMDDERDLCRGPQPSSRVIPPEDGQEG
SQDLQNLPGATNLSREQDERALPPETVPEAGELEGQTPRENLEKDLLEVRGETKTLQSEA
PQLLKGPGEYSKPWNPVNSGSIERQKNPQEESVSFCVAEGDVSTTRGSRRGPLKNRRHMK
RKRDSSPTCQDVRQEAATCLDQGEFSGQLGSHSVGSSGTVGPTSLPEGAETPGRAPSEFR
MCKKSFPYQSQLILHQRTHTGERPFQCDICAKGFIQPSDLQVHERIHTGEKPYSCDLCLK
KLTHNSTLRAHKRTHTQEKPFRCEHCDRAFSHRGNLKVHRRIHSGLKPYVCPECHGAFRH
LGTFKRHRKIHSKRVTQ
Download sequence
Identical sequences F1MSG1
ENSBTAP00000048591 ENSBTAP00000048591

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]