SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000048628 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000048628
Domain Number 1 Region: 402-459
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.35e-25
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 2 Region: 625-682
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.87e-25
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 3 Region: 709-766
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.03e-25
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 4 Region: 486-543
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.91e-24
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 5 Region: 793-850
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.44e-23
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 6 Region: 569-626
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.2e-22
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 7 Region: 346-403
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.35e-22
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 8 Region: 3-56
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 7.32e-21
Family KRAB domain (Kruppel-associated box) 0.00091
Further Details:      
 
Domain Number 9 Region: 229-289
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.1e-20
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 10 Region: 835-886
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000112
Family Classic zinc finger, C2H2 0.0061
Further Details:      
 
Domain Number 11 Region: 313-360
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000555
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 12 Region: 278-312
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000922
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 13 Region: 672-704
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000209
Family Classic zinc finger, C2H2 0.0065
Further Details:      
 
Domain Number 14 Region: 756-788
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000122
Family Classic zinc finger, C2H2 0.0065
Further Details:      
 
Domain Number 15 Region: 533-565
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000292
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 16 Region: 449-481
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000565
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000048628   Gene: ENSBTAG00000037440   Transcript: ENSBTAT00000055187
Sequence length 891
Comment pep:known chromosome:UMD3.1:18:59195356:59228901:1 gene:ENSBTAG00000037440 transcript:ENSBTAT00000055187 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VVSFQERLTCEDVAIEFTQEEWEFLDPAQRALYRDVMLETYRNLLSVGEDDFLPELPIST
LEHEKKLWTVGSDVKVDKNTMKIVSILVCALSYFPKDMQSQDKFSQSVGSAILCLTLVNK
YTKSTLYLLYFGAIKNSAWLEVRSSIADLENYVVSKKKKKKNYCEQDTYDSFYLVDISPT
HVIKYLQPEANSDKLETFQTSMLGRPESCEIKHFHLWEIITQELKAHKEKPYKCDECGKA
FCGKSILLSHQTVHTGEKPYKCDGCGKAFTHSSQLRRHKKIHTGEKRYKCDECGKALTHS
SHLRRHKKIHTGDICEKVFKRNAKLAGHQRVHTREKRYKCGECGEAFRLKSTLLSHQTVH
TGEKPYKCDECGKVFTHSSQLRRHKKIHTGKKLFKCDICDKVFSKNSNLAGHQTVHTGEK
PYKCDECGKAFRVKSNLLQHQTVHTGEKPYKCDECGKAFSHSSHLRRHKKIHTGKKLFKC
DICDKVFSKNSNLAGHQTVHTGEKPYKCDECGKAFRVKSNLLSHQTVHTGEKPYKCGECG
EAFRLKSTLLSHQTVHTGEKPYKCECGEAFRLKSTLLSHQTVHTGEKPYKCGECGKAFTH
SSQLRRHKKIHTGKKLFKCDICDKVFSRNSNLAGHQTVHTGEKPYKCDECGKAFRVKSTL
LMHQAVHTGEKPYKCDECGKAFGVKSSLLQHQTVHTGEKPYKCDECGTAFSAKSTLLRHQ
TVHTGEKPYKCDECGKAFRLKSYVLNHQTVHTGEKPYKCDECGKAFCVKSKLLSHQTLHT
GEKPYKCDECGEAFRVKSILLSHQTVHTGEKPYKCDECGKVFGQKPHLRLHWRIHTGERP
FRCDECGKFFSRNSHLTSHRRIHIEKPFKCFECGKSFIQVSTLTKHQKIHT
Download sequence
Identical sequences M0QW41
ENSBTAP00000047636 ENSBTAP00000048628

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]