SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000048632 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000048632
Domain Number 1 Region: 354-411
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.14e-26
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 2 Region: 8-69
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.05e-23
Family KRAB domain (Kruppel-associated box) 0.00098
Further Details:      
 
Domain Number 3 Region: 410-467
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.52e-23
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 4 Region: 452-504
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.28e-20
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 5 Region: 299-355
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.9e-20
Family Classic zinc finger, C2H2 0.0069
Further Details:      
 
Domain Number 6 Region: 182-233
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000154
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000048632
Domain Number - Region: 151-193
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00169
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number - Region: 250-299
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0618
Family Classic zinc finger, C2H2 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000048632   Gene: ENSBTAG00000039493   Transcript: ENSBTAT00000056477
Sequence length 515
Comment pep:known chromosome:UMD3.1:7:15324727:15346774:1 gene:ENSBTAG00000039493 transcript:ENSBTAT00000056477 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAGLLTTWSQELVTFEEVSVDFSQEEWALLAPTQKILYRDVMLENFRNLASVGYHLCKH
SPITEVAQEELRPEGRGILQSACTDGATQLKSKDVILMQNVPGEKTANGIKMVRFTRNDS
CFLRLGDLCEFQEIKTAAAPKQEETLEAPTLPGEKPLECDHCRKFFRKNYHLIRTRYCKG
KKCYKYKEYGRDFGHPSTLRNHLCTHIGEKILEFSDCGKTFNQESPLRKHFRTLTGEKSE
CNQHLISKLHSSFSVHKQIPTEEKLHEHSDCGKRSFHSVHKKMCTVKESSKCNGHGKVFT
GPLSLQICLRPHTGEKAYECRDCGKAFVFQSSLKKHVRSHTGEKPYECNHCGKSFSQSSH
LNVHKRTHTGEKPYDCKECGKAFTVPSSLQKHMRTHTGEKPYECSDCGKAFIDQSSLKKH
TRSHTGEKPYECNHCGKSFSTGSYLIVHKRAHTGEKTYACKECGKAFRNSSCLRVHMRTH
TGEKPYKCIQCGKAFSTSTNLIMHKRIHTGQKLCE
Download sequence
Identical sequences F1MQS0
9913.ENSBTAP00000048632 XP_005208703.1.76553 ENSBTAP00000048632 ENSBTAP00000048632

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]