SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000048684 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000048684
Domain Number 1 Region: 539-596
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.96e-25
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 2 Region: 483-540
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.46e-24
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 3 Region: 22-82
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.31e-22
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 4 Region: 427-484
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.9e-22
Family Classic zinc finger, C2H2 0.0067
Further Details:      
 
Domain Number 5 Region: 371-428
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.25e-21
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 6 Region: 641-693
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.07e-18
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 7 Region: 329-381
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.27e-16
Family Classic zinc finger, C2H2 0.009
Further Details:      
 
Domain Number 8 Region: 595-652
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.32e-16
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 9 Region: 289-344
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000358
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 10 Region: 236-286
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000157
Family Classic zinc finger, C2H2 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000048684   Gene: ENSBTAG00000040603   Transcript: ENSBTAT00000052898
Sequence length 702
Comment pep:known chromosome:UMD3.1:18:57900691:57910762:1 gene:ENSBTAG00000040603 transcript:ENSBTAT00000052898 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLADMNLPQRPQVLGLEEQDVSCEGLVSFEDVTMDFSREEWQQLDPAQRHLYQDVMLEIY
SHFFSVGYHIPNPEIIFRIEEGKEPWVRKTELPCQRYHEGEFGLETPQREISEEASFHNE
MMGGVTRDGSWCSILEELWKQADQTERDPKNQNKPSHQGAFFNKKTLNTERDCDYKYPGT
VIQAKPHLVSSQKGPHKRCSVAKRLKPNLEATHQNQSSITKHLDDMVGSGQPVIHSSSSA
SCKNTHTGENFHEGNTCTKAFSQKQLLTQHQVHAQEKPDKCTECGRDLTHKSHLLEQQRF
HSVENLQECGKCGKAFTSQPKLGVCVTDHTGNIPYICKECGKVFIQRPELVTHQKTHTRK
KPHKCHECGKTFFQMLSLFRHQRTHTRERLYECGECGKGFSQNSTLSIHQKIHTGERQYV
CSECGKAFTQKSTLSLHQRIHSGEKSYVCIECGQAFIQKAHLIVHQRSHTGEKPYQCHSC
GKSFISKSQLDIHHRIHTGEKPYECSDCGKTFTQKSHLNIHQKIHTGERHYVCSECGKAF
NQKSILSMHQRIHTGEKPYKCSDCGKAFTSKSQFREHQRIHTGEKPYVCAACGKAFNGRS
NFHKHQMTHNRERTFACYKCGNTFVEKSELITHQRTHIGEKPYECCDCGKSFSRKPQLKV
HQRIHTGERPYVCSKCGKSFNNRSNFNKHQTTHTRDKSYKSS
Download sequence
Identical sequences E1BGN6
9913.ENSBTAP00000048684 ENSBTAP00000048684 ENSBTAP00000048684

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]