SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000048822 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000048822
Domain Number 1 Region: 395-451
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.34e-23
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 2 Region: 451-507
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.06e-22
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 3 Region: 356-408
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.12e-20
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 4 Region: 496-548
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.07e-17
Family Classic zinc finger, C2H2 0.0028
Further Details:      
 
Domain Number 5 Region: 263-322
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.33e-17
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 6 Region: 195-218,261-288
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000878
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 7 Region: 312-345
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000126
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000048822   Gene: ENSBTAG00000032187   Transcript: ENSBTAT00000054468
Sequence length 550
Comment pep:known chromosome:UMD3.1:3:23794923:23798630:1 gene:ENSBTAG00000032187 transcript:ENSBTAT00000054468 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEQDDKQGVCEAQDSQDKGMGSDFENCEDREGDPDERGMGSNPQDADKREGHLGQEMGSD
PQDEAPRGHSEERELMSNICTEGLLSEEDGVASREEEDDQSGVVEMAMFPGLSESDSISR
SPQEEEEEESAGENRLEEEEEQPPPAVLPWRRHLSLGSRHRGDKPAHRRFRRLHHPMSMD
LGELDSLMASIMDAPTICPDCGESFSPGAAFLQHQRIHRLAEAAAAASLEPFGFAGECEA
VVGMMGVGGGFGAGPALARPPREKPFRCGECGKGFSRNTYLTNHLRLHTGERPNLCADCG
KSFSWRADLLKHRRLHTGEKPYPCPECGEAFSLSSHLLSHRRAHAAASGAGPAALRPFAC
GECGKGFVRRSHLANHQRIHTGEKPHGCSECGKRFSWRSDLVKHQRVHTGEKPYMCSECG
ETFSVSSHLFTHKRTHSGERPYVCRECGKGFGRNSHLVNHLRVHTGEKPFRCGQCEKRFS
DFSTLTQHQRTHTGEKPYTCIECGKSFIQSSHLIRHRRIHTGNKPHKCAGCGKGFRYKTH
LAQHQKLHLC
Download sequence
Identical sequences E1B8V4
ENSBTAP00000048822 9913.ENSBTAP00000048822 NP_001179347.1.59421 NP_001179347.1.76553 XP_005204103.1.76553 XP_015318857.1.76553 XP_019812271.1.53367 ENSBTAP00000048822

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]