SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000048845 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000048845
Domain Number 1 Region: 305-362
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.97e-24
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 2 Region: 69-131
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 7.59e-22
Family KRAB domain (Kruppel-associated box) 0.0015
Further Details:      
 
Domain Number 3 Region: 361-418
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.09e-22
Family Classic zinc finger, C2H2 0.0091
Further Details:      
 
Domain Number 4 Region: 417-474
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.96e-21
Family Classic zinc finger, C2H2 0.0076
Further Details:      
 
Domain Number 5 Region: 267-319
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.06e-19
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 6 Region: 459-511
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.6e-18
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 7 Region: 2-40
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 0.0000595
Family SCAN domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000048845   Gene: ENSBTAG00000039287   Transcript: ENSBTAT00000052349
Sequence length 524
Comment pep:known chromosome:UMD3.1:3:106259858:106275253:-1 gene:ENSBTAG00000039287 transcript:ENSBTAT00000052349 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLQQLLITLPTEASTWVKLHHPENAKEGAPLWEDVTKMFEGGALLSQDADETQGESLKDE
LTPGTPTTDSQELLTFKDISVDFTQEEWGQLAPAHRNLYREVMLENYGNLVSVAGCQLSK
PSVISQLEKGEEPWMTEKEGPGDPNSDLKSKTETSASNAKYNILQEQLYHGMMMERFMRD
DVIYSTLKKVSEYDDELEKHQDRHGRNVRQTIMTHKKRSQETYKFGKNIVSSNVVIEQRL
RKCDTPRKRNKCKSDVINHPTSYIRVKTYECNICEKAFKQPIHLTEHMRIHTGEKPFRCK
ECGRAFSQSASLTTHQRIHTGEKPFECEECGKAFRHRSSLNQHHRTHTGEKPYICDKCQK
AFSQNISLIQHLRTHSGEKPFTCNECGKTFRQIRHLSEHIRIHTGEKPYACTACCKTFSH
RAYLTHHQRIHTGERPYKCKECGKAFRQRIHLSNHKTVHTGVKAYECNRCGKAYRHDSSF
KKHQRHHTGEKPYECNECGKAFSYNSSLTRHHEIHRRNVFQNNI
Download sequence
Identical sequences A7MBI1
ENSBTAP00000048845 9913.ENSBTAP00000048845 NP_001095533.1.59421 NP_001095533.1.76553 ENSBTAP00000048845

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]