SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000048894 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000048894
Domain Number 1 Region: 298-354
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.7e-25
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 2 Region: 354-410
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.75e-22
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 3 Region: 242-298
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.29e-22
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 4 Region: 395-447
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.01e-20
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 5 Region: 203-255
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.47e-17
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000048894   Gene: ENSBTAG00000019039   Transcript: ENSBTAT00000026729
Sequence length 456
Comment pep:known chromosome:UMD3.1:28:46050993:46053236:1 gene:ENSBTAG00000019039 transcript:ENSBTAT00000026729 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LHLKVLLIYDGIYNHRGGVSNPELDLSTCQKWRKVSSNISRNHKQCGDSSKNMESEDYPS
LKVPIQMATQDSSFCKKEPQDPQESKSLFVPEESTERKLTGAKSPPIEHCSENLQDKLVA
DVKEVVLPLLKGETVCHTGQLKESLEPFDYNHKDVCGWKSRVASHHYQRAHTEEKPCSHQ
DCGKTCTASPGGHPGEKIRPSQKVFKCSQCGRDFRERSDLVLHQRDHTEEKPYRCDQCGK
GFTRSSSLLIHREVHADEKPYKCDKCGKGFTRSSSLLIHHSVHTGEKPYKCDKCGKGFTQ
SSKLHIHQRVHTGEKPYECGECGMSFSQRSNLHIHQRIHTGERPYKCGECGKGFSQSSNL
HIHRCSHTGEKPYQCYDCGKGFSQSSDLRIHLRVHTGEKPYHCGKCGKGFSQSSKLLIHQ
RVHTGEKPYECNKCGKGFSQSSNLHIHQRVHRKDPH
Download sequence
Identical sequences F1MSU1
ENSBTAP00000048894 ENSBTAP00000048894

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]