SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000048978 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000048978
Domain Number 1 Region: 162-219
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.89e-24
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 2 Region: 274-331
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.95e-24
Family Classic zinc finger, C2H2 0.0026
Further Details:      
 
Domain Number 3 Region: 330-387
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.74e-23
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 4 Region: 5-56
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.75e-22
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 5 Region: 218-275
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.46e-21
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 6 Region: 386-441
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.55e-21
Family Classic zinc finger, C2H2 0.0028
Further Details:      
 
Domain Number 7 Region: 127-176
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000726
Family Classic zinc finger, C2H2 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000048978   Gene: ENSBTAG00000016513   Transcript: ENSBTAT00000021950
Sequence length 459
Comment pep:known chromosome:UMD3.1:18:61020212:61032896:-1 gene:ENSBTAG00000016513 transcript:ENSBTAT00000021950 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAHGRKGLVTFSDVAIDFSQEEWACLDSRQRDLYWDVMLENYSNLVSLDLESPYETKSLP
SQKNTYGMNFSKRTSNRKSKSRGLDWTCEGELDRSRAPRERLATQRRIRESTTVRNTRNS
LPVDNSYEWKEGGKVFSRGYLLLHIKISKCEKPYQCKECKKAFRWGNQLTQHQKIHTGEK
PYECKDCGKAFRWGSSLVIHRRIHTGEKPYECKDCGKAFRRGDELTQHQRFHTGEKDYEC
KDCGKTFSRVYKLIQHKRIHSGEKPFECKDCGKAFICGSSLVQHKRIHTGEKPYECQECG
KAFTRVNYLTQHQKIHTGEKPHECKECGKAFRWGSSLVKHERIHTGEKPYKCTECGKAFN
CGYHLTQHERIHTGETPYRCKECGKAFIYGSSLVKHERIHTGFKPYGCQECGKAFSHSHQ
LTQHQKTHTGEKPSECKECGKATCNHGIHLRDDERIPTV
Download sequence
Identical sequences E1B7L3
ENSBTAP00000048978 ENSBTAP00000048978

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]