SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000049039 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000049039
Domain Number 1 Region: 181-238
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.52e-25
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 2 Region: 237-294
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.89e-24
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 3 Region: 294-350
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.93e-24
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 4 Region: 3-64
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 8.37e-24
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 5 Region: 349-406
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.9e-23
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 6 Region: 125-182
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.29e-20
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 7 Region: 395-449
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.24e-17
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000049039   Gene: ENSBTAG00000038589   Transcript: ENSBTAT00000054093
Sequence length 460
Comment pep:known chromosome:UMD3.1:X:90997109:91000794:1 gene:ENSBTAG00000038589 transcript:ENSBTAT00000054093 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RLLLQGSVSFEDVAVDFTRQEWHTLDLAQRTMHRDVMLENYSNLASVGLCVAKPEMIFKL
ERGEELWILEEESSDNGYTVIYHSCLSLPASGANSSVWGNSLRHDNDLQHRKIQTLDQTV
KYQKAFYKRMSFVGHKRTHTGERNFECNECGKTYCRKSNLIEHLRIHTGERPYKCGECAK
TFSARSYLIAHQKTHTGEKPFECDECGKSFGRKSQLILHQRTHTGERPYECTECGKTFSE
KATLMIHQRTHTGEKPYECGECGKTFRVKISLTQHERTHTGEKPYECGACGKNFGAKKSL
NQHQRIHTGEKPYKCGECGKFFRLKMTLNNHQRTHTGEKPYQCNECGKSFSVHSSLGIHQ
RIHTGEKPYECNKCGNAFYVKARLIEHQRMHSGEKPYECSDCGKIFSMKKSLCQHQRTHT
GEKERPFECQECGKAFWQKAHLTEHQRTHLGQPLPCTVEK
Download sequence
Identical sequences F1MV59
ENSBTAP00000049039 9913.ENSBTAP00000049039 ENSBTAP00000049039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]