SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000049054 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000049054
Domain Number 1 Region: 420-477
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.94e-22
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 2 Region: 22-81
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.14e-22
Family KRAB domain (Kruppel-associated box) 0.0015
Further Details:      
 
Domain Number 3 Region: 308-365
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.93e-21
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 4 Region: 364-421
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.36e-20
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 5 Region: 270-322
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.18e-19
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 6 Region: 464-523
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.79e-18
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000049054   Gene: ENSBTAG00000039453   Transcript: ENSBTAT00000055447
Sequence length 568
Comment pep:known chromosome:UMD3.1:18:65898624:65902938:1 gene:ENSBTAG00000039453 transcript:ENSBTAT00000055447 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ASGRPPFLQVPMAAAAAQPDQEQGLMAFEDVAVHFSQEEWGLLDTAQRALYRRVMLENFA
LLASLGLSVSRPRVVTQLECGNEPWVLSGADVTLAWDAQRRPHHGSPPLVEDGCVSGEAP
FPGAFGDGSPLAPARVLPTAGACERGKIPEGRRSISPSRERRPTGVSVIYWERLRLGPGR
GDASVSLRLTSSLRPPPGDKALAEHPTPSQPPRVSERRKPWAREAPGGAFSSAPGAPGAR
GMGPAWREPPGWAELSEALQPGPGLLSGEKPFECRACSKVFVKSSDLLKHLRTHTGERPY
ECTQCGKAFSQTSHLTQHQRIHSGETPYSCLACGQAFRHSSSLVRHQRIHTAEKAFRCAE
CGKAFSHRSNLSQHRKIHAGGRPYACARCGRSFCRNSHLIQHERTHTGEKPFACALCGAA
FSQGSSLFKHRRVHTGEKPFACAQCGRAFSHSSNLRQHRLLHTGERPFRCADCGKAFAKG
AVLLSHRRIHTGEKPFVCAHCGRAFRERPALFHHQRLHTGEKPARRPRAGPRPPSRPPSG
ASPEGALGREAGLPATSGPATILRTTEA
Download sequence
Identical sequences F1MUV6
ENSBTAP00000049054 9913.ENSBTAP00000049054 ENSBTAP00000049054

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]