SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000049073 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000049073
Domain Number 1 Region: 41-134
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 3.39e-36
Family SCAN domain 0.0000083
Further Details:      
 
Domain Number 2 Region: 640-696
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.92e-24
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 3 Region: 370-427
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.07e-23
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 4 Region: 583-640
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.11e-22
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 5 Region: 528-584
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.11e-21
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 6 Region: 681-733
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.34e-18
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 7 Region: 412-464
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.71e-17
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 8 Region: 490-541
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000257
Family Classic zinc finger, C2H2 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000049073   Gene: ENSBTAG00000037581   Transcript: ENSBTAT00000056154
Sequence length 740
Comment pep:known chromosome:UMD3.1:18:65971580:65980686:-1 gene:ENSBTAG00000037581 transcript:ENSBTAT00000056154 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PSLVFPMRPAALGSPGRASLEDEGPVTVKLEDSEEDEPAAWDLGPEAARQQFRRFRYEEA
AGPGQALAQLRELCRQWLRPEAHSKEQMLELLVLEQFLGVLPPEIQARVRGQQPGSPEEA
AALVEGFRREPGGPRRWVTVQVQGQEVLSERTEPPDFQALPQPIPETPEPGLEMLPGATE
QSTLGLRVKEESEVTEEPEPLHPRPLSSLQGTPFTLLPDQARDCVVVLDQASPHSEPGPE
VSSWRQHRGALWQEEAGGIFSPGFTLQMDNVSVDPDIMSAHVHLPWDLGEASLTGRLESA
SREGGFSQALVPSSDLRGEPDPTEDTCQGLSHGLGAASWRAPRGRSRARGRPGTGAGAER
GGRCDVCGKVFSQRSNLLRHQKIHTGERPFVCGECGRSFSRSSHLLRHQLTHTEERPFVC
ADCGQGFVRSGRLEEHRRVHTGEQPFRCAECGQSFRQRSNLLQHQRIHGDPPGPSAAPPA
PPGAPEPPGPFPCSECRQSFARRAVLLEHQAVHTGDKCFGCAECGERFGRRTVLLQHRRV
HSGERPFRCAECGQSFRQRSNLTQHRRIHTGERPFTCAECGKAFRQRPTLTQHLRVHTGE
KPFACPECGQRFSQRLKLTRHQRTHTGEKPYRCRECGLGFTQVSRLTEHQRIHTGERPFA
CPECGQRFRQHANLTQHRRIHTGERPYACPECGKAFRQRPTLTQHLRTHRREKPFACQDC
GRRFHQSTKLIQHQRVHSAE
Download sequence
Identical sequences F1MUM3
ENSBTAP00000049073 ENSBTAP00000049073

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]