SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000049089 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000049089
Domain Number 1 Region: 266-323
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.94e-26
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 2 Region: 350-407
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.34e-25
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 3 Region: 742-799
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.13e-24
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 4 Region: 434-491
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.28e-23
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Domain Number 5 Region: 518-575
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.54e-23
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 6 Region: 630-687
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.64e-22
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 7 Region: 182-239
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.34e-21
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 8 Region: 575-631
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.21e-20
Family Classic zinc finger, C2H2 0.0084
Further Details:      
 
Domain Number 9 Region: 687-743
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.99e-19
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 
Domain Number 10 Region: 799-854
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.58e-18
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 11 Region: 144-196
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.63e-16
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 12 Region: 481-513
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000127
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 13 Region: 231-260
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000178
Family Classic zinc finger, C2H2 0.0093
Further Details:      
 
Domain Number 14 Region: 313-345
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000119
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 15 Region: 397-429
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000613
Family Classic zinc finger, C2H2 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000049089   Gene: ENSBTAG00000039711   Transcript: ENSBTAT00000056233
Sequence length 905
Comment pep:known chromosome:UMD3.1:7:41404242:41406959:-1 gene:ENSBTAG00000039711 transcript:ENSBTAT00000056233 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VSHLKTRGTEDEESTEKYENIRNAESVWPKVEGLHKDHMQESKVGETCDWDSKVENQMDK
PEGKRMKEDKSGFREKIGKARNTANIKTEQEDEASEKSLHLSSKYVTHQTVPIEQKNSEQ
VKCVESINGNSHPSLQQKASAVKKSHKCDDCGKSFKYNSRLIQHKIMHTGEKRYECDDCG
GTFRSSSSLRVHKRIHTGEKPYKCEECGKAYMSYSSLINHKSTHSGEKNCKCDECGKSFN
YSSVLDQHKRIHTGEKPYECGECGKAFRNSSGLRVHKRIHTGEKPYECDICGKTFSNSSG
LRVHKRIHTGEKPYECDECGKAFITCRTLLNHKSIHFGDKPYKCDECEKSFNYSSLLIQH
KVIHTGEKPYECDECGKAFRNSSGLIVHKRIHTGEKPYKCDVCGKAFSYSSGLAVHKSIH
PGKKAHECKECGKSFSYNSLLLQHRTIHTGERPYVCDVCGKTFRNNSGLKVHRRLHTGEK
PYKCDVCGKAYISRSSLKNHKGIHLGEKPYKCSYCEKSFNYSSALEQHKRIHTREKPFGC
DECGKAFRNNSGLKVHKRIHTGERPYKCEECGKAYISLSSLINHKSVHPGEKPYKCDECE
KAFITYRTLINHKKIHLGEKPYKCDVCEKSFNYTSLLSQHRRVHTREKPYECDRCEKVFR
NNSSLKVHKRIHTGEKPYKCDVCGKAYISHSSLINHKSTHPGKTPYTCDECGKAFFSNRT
LISHKRVHLGEKPFKCVECGKSFSYSSLLSQHKRIHTGEKPYVCDGCGKAFRNSSGLTVH
KRIHTGEKPYGCDECGKAYISHSSLINHKSVHSGQQPYNCECGKSFNYRSVLDQHKRIHT
GKKLYQCNECGKAFNIRSNLTKHKRIHTGGEYLSVTNMGSHSGTSQKRTHEGGNALDGTR
MSMSL
Download sequence
Identical sequences F1MXU3
ENSBTAP00000049089 ENSBTAP00000049089

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]