SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000049250 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000049250
Domain Number 1 Region: 304-361
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.04e-23
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 2 Region: 472-529
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.7e-22
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 3 Region: 361-417
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.12e-22
Family Classic zinc finger, C2H2 0.0085
Further Details:      
 
Domain Number 4 Region: 416-473
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.05e-21
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 5 Region: 514-566
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.96e-21
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 6 Region: 251-305
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.53e-20
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 7 Region: 23-81
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.27e-19
Family KRAB domain (Kruppel-associated box) 0.0019
Further Details:      
 
Domain Number 8 Region: 212-259
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000403
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000049250
Domain Number - Region: 165-209
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0477
Family Classic zinc finger, C2H2 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000049250   Gene: ENSBTAG00000037981   Transcript: ENSBTAT00000055561
Sequence length 589
Comment pep:known chromosome:UMD3.1:18:64976079:64981696:-1 gene:ENSBTAG00000037981 transcript:ENSBTAT00000055561 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAALRDPPQTPMRTEVLRDSSKACVTFEDVAIYFSQEEWGLLDEVQRHLYCKVMLENF
ALTASMVCLHETQTKETPSEQNVSLEALSQVRTPKVGPFTENAHPCEKCVPILKDILYPA
DLPGQKPYFTGASANLQQLQKHFTTEKSDVDKAAFVKSCIVQVSGNPFTCRKVGMDLPGT
VGLLQHQITSNGEKPNKITKFGETFNGRKSHYKLRECGKATSHKHNLVYHLRVSARKRVY
EFSKYGKAMHCKYSLVQLQRVRTGERSYECSECGKSFRQRATLIIHQRVHTGERPYKCGE
CGKSFSQCSNLIEHCRIHSGERPFECEECGKTFGCKSNLVRHRRTHTGEKPYECSECGKF
FRQSFTLVQHRRIHTTARPYVCVQCGKSFSQRATLIRHQRVHTTERPYECGECGKAFGSK
SKLERHNRSHTGEKPYECAECEKSFRQSYSLVEHQRIHSRTRPFECGQCGKSFSRRAIFT
KHQRIHTGERPYKCGECGKSFSRSTSLIQHCSIHTGARPYECGQCGKSFRQKSVLIQHQV
VHTGERPYECSKCGKSFSQRSSLNLHRKFHTVEWLHECRKYGKSFTPNS
Download sequence
Identical sequences E1BKR7
9913.ENSBTAP00000049250 ENSBTAP00000049250 ENSBTAP00000049250 XP_002695538.3.76553 XP_010855973.1.44457 XP_609455.7.59421

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]