SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000049457 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000049457
Domain Number 1 Region: 285-342
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.02e-25
Family Classic zinc finger, C2H2 0.0029
Further Details:      
 
Domain Number 2 Region: 397-454
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.95e-25
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 3 Region: 453-510
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.56e-25
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 4 Region: 537-594
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.61e-25
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 5 Region: 341-398
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.61e-25
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 6 Region: 579-631
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.36e-21
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 7 Region: 230-286
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.36e-19
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 8 Region: 192-243
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000362
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 9 Region: 500-532
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000367
Family Classic zinc finger, C2H2 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000049457   Gene: ENSBTAG00000016203   Transcript: ENSBTAT00000052907
Sequence length 638
Comment pep:known chromosome:UMD3.1:14:1445334:1456750:-1 gene:ENSBTAG00000016203 transcript:ENSBTAT00000052907 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VELSVPGPSPWTPRAQAFVDAPAETHPGSALHGSLCCGDAEPGATSPHHQQPGWDTRTKG
QEFVQKEEVSEDLESQVEISDSSGSDAPQTPELGGLHCGVEERDCGLPEDERQMHRPHQE
GAFTLAQMLLRSPSGEREVDCDDIKSSCSWSPSPVECQGPPAEGRPHPLGIRSLPCSLDL
PSCTGLHVAESPFICSECGKTFEGDPGLTQHQTGHTGHKSFICNECGRLFSTHTGFLQHQ
LTHHGEKLHMCSECGKAFCQSSSLKKHQKSHVSEKPYECSECGKTFRRSSNLIQHQRIHS
GEKPYVCHACGKAFRRSSNLVKHQRVHTGEKPFECTECGRAFSQSSHMRKHQRVHTGERP
YSCSECGKPFSRVSNLIKHHRVHTGEKPYKCSECGKAFSQSSSLIQHRRIHTGEKPHVCA
VCGKAFSYSSVLRKHQIIHTGEKPYECGVCGKAFSHSSALVQHQGVHTGDKPYECRECGK
TFGRSSNLILHQRVHTGEKPYECTECGKTFSQSSTLIQHQRIHNGLKPHECNQCGKAFNR
SSNLIHHQKVHTGEKPYTCVECGKGFSQSSHLIQHQIIHTGERPYQCSECGKSFSQRSVL
IQHQRIHTGVKPYDCTACGKAFSQRSKLTKHQLIHTRE
Download sequence
Identical sequences F1MJD3
ENSBTAP00000049457 ENSBTAP00000049457

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]