SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000049540 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000049540
Domain Number 1 Region: 120-177
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.12e-26
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 2 Region: 402-459
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.41e-24
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 3 Region: 288-345
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.52e-24
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 4 Region: 458-515
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.06e-24
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 5 Region: 514-571
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.94e-23
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 6 Region: 797-853
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.35e-23
Family Classic zinc finger, C2H2 0.0077
Further Details:      
 
Domain Number 7 Region: 176-233
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.35e-22
Family Classic zinc finger, C2H2 0.0065
Further Details:      
 
Domain Number 8 Region: 838-890
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.14e-22
Family Classic zinc finger, C2H2 0.0029
Further Details:      
 
Domain Number 9 Region: 571-627
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.81e-22
Family Classic zinc finger, C2H2 0.0082
Further Details:      
 
Domain Number 10 Region: 232-289
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.79e-22
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 11 Region: 741-797
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.39e-21
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 12 Region: 3-56
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.53e-21
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 13 Region: 345-403
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.66e-20
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 14 Region: 631-684
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.12e-20
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Domain Number 15 Region: 669-721
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6e-19
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 16 Region: 73-121
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.31e-16
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000049540   Gene: ENSBTAG00000004925   Transcript: ENSBTAT00000054007
Sequence length 896
Comment pep:known chromosome:UMD3.1:18:60249393:60304930:1 gene:ENSBTAG00000004925 transcript:ENSBTAT00000054007 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VFSFQAQLTFKDVAIEFTQEEWECLDPAQRALYRDVMVETLSNIVSLGQYFSCPCTVEFT
VKSEEKIDEFNEAHRTIHTSEKSYKYNECGKTPNYGLHLTGHQRIHTGEKPYKCNECGKV
FSQNSYLAKHRRIHTGEKPYKCNECGKAFSQKGNLASHQRIHTGEKPYKCNECGKMFSIR
STLVSHQIIHTGEKHYKCNECGKTFYFGSHLIQHQIIHSGDKPYKCDICGKVFGQNSYLA
VHRRIHTGEKPYECKDCGKIFNHSSNLKRHQIIHTGQKLCKCDICGRVFSYNSYLEIHRR
THTGEKPYKCIECGKVFNRNSNLAIHQRIHTGEKPYKCNECGSCFSRKAYLAKHQSVHTK
GKPYKTKCDICEKVFTQSSYLTVHQRIHTGEKPYKCNECGKVFSQNSYLAKHRRIHTGEK
PYKCNECGKVFHHKANLASHQRLHTGEKPYKCNECGRAFSQKGNLASHQRIHTGEKPYQC
NECGKMFSSRSTLVSHQVIHTGEKHYKCNECSKTFYFGSHLKQHQIIHSGDKPYKCDVCG
KVFGQNSYLAVHRRIHTGEKPYKCKDCGKIFNHSSNFKRHQIIHTGQKLCKCDICGRVFS
FNSYLARHRRTHTGEKPYKCNECGKVFNRNNSYLTCHKRIHTGETPYKCNVCGKTFRYPS
GLWRHMIKHTGRKPFKCDVCGRVFNQNKDLAVHHRIHTGEKPYKCNECGKVFGQKAHLKT
HHQQIQTAVTAYRCNACGKYFHHRTTLIRHQHVHTGQKPYKCNECGKFFRQKVTLIRHQH
VHTGNKPYKCNECGKFFNQKSNLVRHQTIHNGDRPYKCHHCGQLFSLKGSLAAHQRIHTG
EKPYKCSECGKVFNRNSNLVVHQRIHTGEKPYKCNECGKMFSSRPTLISHQFIHTG
Download sequence
Identical sequences F1MJ44
ENSBTAP00000049540 ENSBTAP00000049540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]