SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000049685 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000049685
Domain Number 1 Region: 398-455
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.62e-26
Family Classic zinc finger, C2H2 0.0029
Further Details:      
 
Domain Number 2 Region: 510-567
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.41e-26
Family Classic zinc finger, C2H2 0.0026
Further Details:      
 
Domain Number 3 Region: 342-399
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.54e-25
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 4 Region: 174-231
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.69e-25
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 5 Region: 286-343
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.2e-24
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 6 Region: 566-623
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.6e-24
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 7 Region: 230-287
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.47e-24
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 8 Region: 454-511
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.48e-24
Family Classic zinc finger, C2H2 0.0028
Further Details:      
 
Domain Number 9 Region: 2-51
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.35e-22
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 10 Region: 622-679
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.27e-21
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 11 Region: 119-175
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.41e-21
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000049685   Gene: ENSBTAG00000038050   Transcript: ENSBTAT00000054598
Sequence length 687
Comment pep:known chromosome:UMD3.1:18:47700143:47727252:-1 gene:ENSBTAG00000038050 transcript:ENSBTAT00000054598 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQRSVMFRDVAIDFSQEEWDCLDSAQRDLYRDVMLENYSNLVSLDLPSRGANKLLSPKK
DIYETGLSQWEMSARLENCDLENSSSRDHLEVKGTLEKQQENQAYFSQGMIIYDNMSIFN
QHAYLSQHPRCHSTEKPYKCKECGKAFRRASHLTQHQSIHTGEKPYECKQCGKAFSRDSQ
LSLHQRLHTGEKPYACKECGKAFTQSSQLILHHRIHTGEKPYKCEECGKAFIRSSQLTRH
QKVHTGEKPYECKECGKAFTQNSQLTLHQRLHTGEKLYECKECRKVFTQLSQLILHKRIH
TGEKPYECKECGKAFICGSQLSQHQKIHNGEKPYECQECGKAFIRGSLLMQHQRIHTGEK
PYKCEECGKAFIRGSQLTQHQRIHTNEKPYECKECGKTFSHGSQLTQHQRIHTGEKPYQC
KECGKAFNRGSLLTRHQRIHTGEKPYECKECGKTFSRGSELTQHERIHTGEKPYECKECG
KSFIRGSQLTQHQRIHTGEKPYECKECRMAFTQSSHLSQHQRLHTGEKPYVCNECGKAFA
RGLLLIQHQRIHTGEKPYQCKECGKAFIRGSQLTQHQRIHTGEKPYGCKECGKAFSHGSQ
LTLHQRIHTGEKPYECKECRKAFTQSSHLSRHQRVHTGEKPYQCRECGKAFTRGSQLTQH
QRIHISEKSFAYKECGIDFSHDSQVYI
Download sequence
Identical sequences F1MML9
ENSBTAP00000049685 ENSBTAP00000049685 9913.ENSBTAP00000049685

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]