SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000049708 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSBTAP00000049708
Domain Number - Region: 310-368
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00187
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number - Region: 355-405
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0385
Family Classic zinc finger, C2H2 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000049708   Gene: ENSBTAG00000040363   Transcript: ENSBTAT00000055136
Sequence length 470
Comment pep:known chromosome:UMD3.1:X:58503872:58505529:1 gene:ENSBTAG00000040363 transcript:ENSBTAT00000055136 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SKNKKYGHFRKDNAQKLQPVSHVTPASEAKTVLPVSVSESRSTDSPVIIEPLSKADSKNI
SPQIVPNSFSELCSPLITFTSSLQHPVETAVSTGDMDKSPHVSKRLPTSETNSTNPKRPK
LSDGIIGEHSLALSPSGIFHTVTTQQSTPDSVHTSLSHIQNGEPCPTAFPKGNVHCKPVS
PLGENGLTKTDFPSVASQNKIVDLTEGNLIVLLHDFYYGQHIGDGQPEPKTHTAFKCLSC
LKVLKNVKFMNHIKHHLELERQRSDSLKYHTTCQHCHCQFPTPFQLQCHIESVHTFKEPS
AVSKIFEFSFETDQVLLQHMKDNHKPGEMPYVCQVCSYRSSFFADVDAHFRGYHGNTKNF
CPFCLKIFKTATPYICHYRRNWEKSFHQCSKCGLQFLTFKEKREHKTQCHQMFKKPKQLE
GLPPETKVVIQVSLEPLQPGLVEVAFTTVNTSHSEPSPPKSKSRRSKRTR
Download sequence
Identical sequences G5E6A3
ENSBTAP00000049708 ENSBTAP00000049708

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]