SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000049765 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000049765
Domain Number 1 Region: 124-181
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.46e-21
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 2 Region: 544-601
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.77e-21
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 3 Region: 166-218
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.82e-20
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 4 Region: 488-545
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.21e-19
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 5 Region: 450-502
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.53e-19
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 6 Region: 68-125
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.11e-18
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 7 Region: 586-638
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.62e-18
Family Classic zinc finger, C2H2 0.0091
Further Details:      
 
Domain Number 8 Region: 32-82
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.54e-17
Family Classic zinc finger, C2H2 0.0085
Further Details:      
 
Domain Number 9 Region: 355-407
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000312
Family Classic zinc finger, C2H2 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000049765   Gene: ENSBTAG00000038034   Transcript: ENSBTAT00000057114
Sequence length 1030
Comment pep:known chromosome:UMD3.1:18:62475322:62481823:-1 gene:ENSBTAG00000038034 transcript:ENSBTAT00000057114 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVGSHVDMAPASTAEGASEKPGPVAPAPPAQYECGECGKSFRWSSRLLHHQRTHTGERPY
KCPDCPKAFKGSSALLYHQRGHTGERPYQCPDCPKAFKRSSLLQIHRSVHTGLRAFTCGQ
CGLAFKWSSHYQYHLRQHTGERPYPCPDCPKAFKNSSSLRRHRHVHTGERPYACGVCGKS
FTQSTNLRQHQRVHTGERPFRCALCPKTFTHSSNLLLHQRTHGGAATAPAPGAGPGPPPR
EPAAGGKVLVSDAYLQRPLPPPSPPAPPPPAPPPVVPELFLAAAETTVGLVYRCEGCELG
FGSEELLLEHQPCPGPEALPPPAAAPSEAPKADPPPPPRSPLPQPAPATAAAPGFACLPC
GKSFRTVAGLSRHQHSHGAAGGQAFRCGSCDGAFPQLASLLAHQQSHVEEAAAGRPPPQA
EAAEVTCPQEPLGPAPGPPAPAPAPASAERPYKCAECGKAFKGSSGLRYHLRDHTGERPY
QCGECGKAFKRSSLLAIHQRVHTGLRAFTCGQCGLTFKWSSHYQYHLRLHSGERPYACGE
CGKAFRNTSCLRRHRHVHTGERPHACGVCGKSFAQTSNLRQHQRVHTGERPFRCPLCPKT
FTHSSNLLLHQRTHSAERPFTCPVCGRSFVMAAYLQRHLRTHAPAAPAAGPQPPAPLAAA
PAPSATQDVHVLPHLQATLSLEVAGGTAPAAAPGPAAPNSQTFLLVQTAQGLQLIPSSVQ
PPTPPPPPPPAPPKLILLPSSGPAGGGSCARQGLRAAGKAGPGAGVVWLPGPGGLGVQRG
SNAAGNVGGQSLIVLQNVAGGETGPQEVSGVQLQPLRPAPELTTVQLQPAQEVTTVQLQP
VTGPLSSSSGGAVTTEAPNLLVVQSGAAEELLADPGPGEPGEGEAGPGVVPDVLFETLQT
EEGLQSVLVLSGADGEQTQLCVQEVETLPSGLAEPPASGPPGQKLLIIRSAPAAELLENG
SAGGGAAALQLLAPPPPGPASAPAGGPAAPGPQMVQVVPAGAAPGGVAPQGLPSIQIVQT
LPAVQLVHTF
Download sequence
Identical sequences F1ML21
ENSBTAP00000049765 NP_001179987.1.59421 NP_001179987.1.76553 XP_010813793.1.76553 ENSBTAP00000049765

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]