SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000049772 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000049772
Domain Number 1 Region: 147-274
Classification Level Classification E-value
Superfamily POZ domain 2.47e-26
Family BTB/POZ domain 0.0013
Further Details:      
 
Domain Number 2 Region: 564-620
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.65e-20
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 3 Region: 525-577
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000061
Family Classic zinc finger, C2H2 0.0085
Further Details:      
 
Domain Number 4 Region: 453-483
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000936
Family Classic zinc finger, C2H2 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000049772   Gene: ENSBTAG00000025130   Transcript: ENSBTAT00000055247
Sequence length 753
Comment pep:known chromosome:UMD3.1:19:23655531:23659389:1 gene:ENSBTAG00000025130 transcript:ENSBTAT00000055247 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KYVHRNIQLKTPISVGLAGPGLGTPGGHIWKAEWSSSSSASLHPRCAGRRPWLCRAKYRT
AARWRHSCSSARRPGPLQIRVCGKRGGAETRPGRGEDGPAGQTDRGPGGRRAAQRSHVPP
WIRRQPGPGLPTCPPGECAGQTMLDTMEAPGHSRQLLLQLNNQRTKGFLCDVIIVVQNAL
FRAHKNVLAASSAYLKSLVVHDNLLNLDHDMVSPAVFRLVLDFIYTGRLADGAEAAAAAA
VAPGAEPSLGAVLAAASYLQIPDLVALCKKRLKRHGKYCHLRGGGARPDSPPSAGPAAYK
EPPLTLPPLPPLPFQKLEEAGPPPDPFRGGGGSPGSEPPGRPDGPSLLYRWMKHEPGLGS
YGDELGRERGSPSERCEERGGDPSASPGGPPLGLAPPPRYAGSLDGPGAGGDGDDYKSSS
EETGSSEDPSPPGGHLEGYPCPHLAYGEPESFGDNLYVCIPCGKGFPSSEQLNAHVEAHV
EEEEALYGRAEAAEVAAGAAGLGPPFGGGGDKVAGAPGGLGELLRPYRCASCDKSYKDPA
TLRQHEKTHWLTRPYPCTICGKKFTQRGTMTRHMRSHLGLKPFACDACGMRFTRQYRLTE
HMRIHSGEKPYECQVCGGKFAQQRNLISHMKMHAVGGAAGAAGALAGLGGLPGVPGPDGK
GKLDFPEGVFAVARLTAEQLSLKQQDKAAAAELLAQTTHFLHDPKVALESLYPLAKFTAE
LGLSPDKAAEVLSQGAHLAAGPDGRTIDRFSPT
Download sequence
Identical sequences F1ML16
ENSBTAP00000049772 ENSBTAP00000049772

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]