SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000049882 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000049882
Domain Number 1 Region: 268-325
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.46e-26
Family Classic zinc finger, C2H2 0.0026
Further Details:      
 
Domain Number 2 Region: 7-68
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 6.02e-26
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 3 Region: 380-437
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.09e-25
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 4 Region: 324-381
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.03e-25
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 5 Region: 437-493
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.33e-24
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 6 Region: 213-269
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.69e-23
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 7 Region: 549-605
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.86e-21
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 8 Region: 590-642
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.57e-18
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 
Domain Number 9 Region: 493-549
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.02e-18
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 10 Region: 174-226
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.17e-16
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000049882   Gene: ENSBTAG00000038869   Transcript: ENSBTAT00000052562
Sequence length 646
Comment pep:known chromosome:UMD3.1:18:47532346:47545032:1 gene:ENSBTAG00000038869 transcript:ENSBTAT00000052562 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HPVILKAMAQGSVVFSDVSIDFSQEEWEFLNPAQRDLYRDVMLENYSNLVSMGLYIPKPQ
VISLLEQGKEPWMIGRELTRGLCSALESMCETKLLSLKKEVYEIESCQREMMGLRKHGFE
YSSFRDVLEYRSHFEKQLGYQNGHFSQEILTHEYMPTFVQQTFFTLHQINNEEKPYECKK
CGKVFSQNSQFLQHQRIHIGEKSYECKECGKFFSCGSHVTRHLKIHTGEKPFECKECGKA
FSCSSYLSQHQRIHTGKKPYECKECGKAFSYCSNLIDHQRIHTGEKPYECKECGKAFTQS
SKLVQHQRIHTGEKPYECKECGKAFSSGSALTNHQRIHTGEKPYDCKECGKAFTQSSQLR
QHQRIHAGEKPFECLECGKAFTQNSQLFQHQRIHTDEKPYECNECGKAFNKCSNLTRHLR
IHTGEKPYNCKECGKDFSRSSNLSIHRRVHTGEKPYRCSVCGKDFSRSSNLSIHQRIHTG
EKPFSCHECGKDFSRRAALQIHQSVHTGRKPHACEVCDRRFTSRSALARHQQGHAGDKAY
LCDTCGRGFSQRANLYLHQRVHTGERPFRCEACGKCFSWSKDLGIHRRVHTGERPYRCAA
CGRDFRHHSALKRHQRVHTGEKPYLCAICGKGFSQRVHLQMHQKVH
Download sequence
Identical sequences F1N7J9
ENSBTAP00000024544 ENSBTAP00000049882

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]