SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000049904 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000049904
Domain Number 1 Region: 247-304
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.68e-24
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 2 Region: 9-68
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 7.85e-22
Family KRAB domain (Kruppel-associated box) 0.0017
Further Details:      
 
Domain Number 3 Region: 304-360
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.7e-20
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 4 Region: 195-248
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.96e-19
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 5 Region: 345-397
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.12e-17
Family Classic zinc finger, C2H2 0.0094
Further Details:      
 
Domain Number 6 Region: 149-201
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000358
Family Classic zinc finger, C2H2 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000049904   Gene: ENSBTAG00000037882   Transcript: ENSBTAT00000054145
Sequence length 407
Comment pep:known chromosome:UMD3.1:18:65866463:65872294:1 gene:ENSBTAG00000037882 transcript:ENSBTAT00000054145 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DPKTQWNASLQGPVTFEDVAVYFSLEEWGLLNLTQKSLYRDVMLENFGLIGSLGFAPSRS
SKVAQMEGEGEAWVPNMVDSVVSRAEARKGSRLSCLCRLQDEDALLELGESCRVRLSEKP
SLEGAPRGSPECSEACPPGSAGQRQQGCHAAQTPFRCSDCGQAFLQAFTLLDHLVAHARE
RPIRGPAGGSSPTENSTLVPHWNAHPGETPHVCNECGRAFSYPSKLRKHQKVHTGIKPFK
CAECGKTFNRKDALVLHQRIHTGERPYQCGECGKAFSVLSTLIRHRKVHIGERPYECRQC
GKLFKYSHSFALHRRVHTGERPYGCGECRKAYVTRSGLYQHRKVHTGERPYECGLCGKTF
TTRSYRNRHQRFHTEERAHECPECGRSFKHGSTLLQHRKVHAAGRPQ
Download sequence
Identical sequences F1MN03
ENSBTAP00000049904 ENSBTAP00000049904 9913.ENSBTAP00000049904

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]