SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000049954 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000049954
Domain Number 1 Region: 198-254
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.04e-22
Family Classic zinc finger, C2H2 0.0082
Further Details:      
 
Domain Number 2 Region: 159-211
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.93e-20
Family Classic zinc finger, C2H2 0.0095
Further Details:      
 
Domain Number 3 Region: 239-291
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.91e-17
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 4 Region: 1-51
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.44e-16
Family KRAB domain (Kruppel-associated box) 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000049954   Gene: ENSBTAG00000040381   Transcript: ENSBTAT00000053980
Sequence length 296
Comment pep:known chromosome:UMD3.1:25:2750040:2761886:1 gene:ENSBTAG00000040381 transcript:ENSBTAT00000053980 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYFSQEEWELLDPTQKALYNDVMQENYETVISLALFVLPKPKVISCLEQGEEPWVQRPLE
FKDSSEELPAGLKLKNDTENIQSLCLSDLEIQAPVAIASRKARLKVPQKTIGKENHGDVH
RVGKLHRDFPVKKKKKLSTWKQELLKLMDLQKKERAAERPFKCQECGKSFRVSSDLIKHQ
RVHTEEKPYKCQQCDKRFRWSSDLNKHLTTHQGIKPYKCSWCGKGFSQKTNLHTHQRTHT
GEKPFTCHECGKKFNQNCHLIKHRRTHTGEQPYTCTTCRRNFSRRSSLLRHQKLHQ
Download sequence
Identical sequences A8E4M3
ENSBTAP00000049954 ENSBTAP00000049954 9913.ENSBTAP00000049954 NP_001103435.1.59421 NP_001103435.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]