SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000050024 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000050024
Domain Number 1 Region: 103-154
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.98e-20
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 2 Region: 34-94
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.64e-17
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 3 Region: 159-214
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000122
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 4 Region: 202-263
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000191
Family Classic zinc finger, C2H2 0.027
Further Details:      
 
Domain Number 5 Region: 281-325
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000074
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000050024   Gene: ENSBTAG00000025113   Transcript: ENSBTAT00000055820
Sequence length 325
Comment pep:known chromosome:UMD3.1:16:8241905:8243480:1 gene:ENSBTAG00000025113 transcript:ENSBTAT00000055820 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ERTHTGEKTCRLLCVRKPSSKAQILFHIRGFTVNEKPYKCSKCEKSFWHHLALSGHQRMH
AGKKLYTCYICGKNFGQSSDLLVHQRSHTGEKLYLCSECCEKAFSGKSDLTSHQRTHNGE
RPYKCNKCEKCFAQKSDLIVHQIVHTGEKPYKCLEHMRSFTWSANLIRHQATHTHTFKCL
EYEKSFSCSSDLIVHQRIHMEEKPHQWSACESGFLLGMDFIAQQKMRTQTEELHYKYSVC
DESFHQSSALLQHQTIHIGEKPYISNVAEKGLETRELSLQNRINHSSEKPYKCLEFLENL
SPSSCLITHKRSHTGENLCICLECG
Download sequence
Identical sequences F1MHE2
ENSBTAP00000050024 ENSBTAP00000050024

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]