SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000050069 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000050069
Domain Number 1 Region: 95-152
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.84e-26
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 2 Region: 151-208
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.06e-23
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 3 Region: 40-96
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.71e-19
Family Classic zinc finger, C2H2 0.0093
Further Details:      
 
Domain Number 4 Region: 197-249
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.13e-19
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 5 Region: 2-53
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000118
Family Classic zinc finger, C2H2 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000050069   Gene: ENSBTAG00000039023   Transcript: ENSBTAT00000057380
Sequence length 261
Comment pep:known chromosome:UMD3.1:17:53969695:53970480:-1 gene:ENSBTAG00000039023 transcript:ENSBTAT00000057380 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIYKCPMCREFFSERADLFMHQKIHTAEKPHKCDKCDKGFFHISELHIHWRDHTGEKVYK
CDDCGKDFSTTTKLNRHKKIHTVEKPYKCYECGKAFNWSSHLQIHMRVHTGEKPYVCSEC
GRGFSNSSNLCMHQRVHTGEKPFKCEECGKAFRHTSSLCMHQRVHTGEKPYKCYECGKAF
SQSSSLCIHQRVHTGEKPYRCCGCGKAFSQSSSLCIHQRVHTGEKPFKCDECGKAFSQST
SLCIHQRVHTKERNHLKISVI
Download sequence
Identical sequences A0A024RBR7 A0A091DL15 A0A096N920 A0A0D9SC79 A0A1U7R451 A0A1U7U9D7 A0A2I2YHN1 A0A2I3GLA1 A0A2J8MCN0 A0A2K5BWF3 A0A2K5HH30 A0A2K5L2W8 A0A2K5PAY7 A0A2K6GPC7 A0A2K6KKG0 A0A2K6NN69 A0A2K6S8Y6 D2GW06 D3ZXN6 E2RH19 E9QPD3 F1MGG4 F2Z502 F6UVW3 F7HJR3 G3HX50 G3U7H8 G7PJF2 H0WZ48 H2NJA0 I3M6A3 M3WEE7 Q8N3J9 W5P383
ENSRNOP00000001338 ENSSTOP00000004974 ENSOGAP00000007840 ENSP00000337320 ENSP00000376205 ENSP00000440645 ENSP00000441405 ENSP00000337320 ENSP00000376205 ENSP00000440645 ENSP00000441405 ENSRNOP00000001338 ENSFCAP00000010278 ENSMUSP00000107048 ENSBTAP00000050069 NP_001075219.1.92730 NP_001181054.1.72884 NP_001191227.1.87134 NP_001191227.1.92137 NP_689650.1.87134 NP_689650.1.92137 XP_002753190.1.60252 XP_002798868.1.72884 XP_003276286.1.23891 XP_003276287.1.23891 XP_003276288.1.23891 XP_003276289.1.23891 XP_003276290.1.23891 XP_003796081.1.62490 XP_003824621.1.60992 XP_003937158.1.74449 XP_004089529.1.23891 XP_004089530.1.23891 XP_004430126.1.5094 XP_004635924.1.9945 XP_004753140.1.14098 XP_005080669.1.91757 XP_005329602.1.77405 XP_005403069.1.28644 XP_005572642.1.63531 XP_005572643.1.63531 XP_005572644.1.63531 XP_005572645.1.63531 XP_005572646.1.63531 XP_005572647.1.63531 XP_005572648.1.63531 XP_005636164.1.84170 XP_005636165.1.84170 XP_005636167.1.84170 XP_006910036.1.64745 XP_007079588.1.5354 XP_007936305.1.48129 XP_008003329.1.81039 XP_008003332.1.81039 XP_008003333.1.81039 XP_008003334.1.81039 XP_008062516.1.4292 XP_008589534.1.73410 XP_008837487.1.79516 XP_008837488.1.79516 XP_008837490.1.79516 XP_008837491.1.79516 XP_008837492.1.79516 XP_008837493.1.79516 XP_010366709.1.97406 XP_010366710.1.97406 XP_010366711.1.97406 XP_010366712.1.97406 XP_010366713.1.97406 XP_010366714.1.97406 XP_010598104.1.64505 XP_010598106.1.64505 XP_010598107.1.64505 XP_011379395.1.92234 XP_011803806.1.43180 XP_011803807.1.43180 XP_011803808.1.43180 XP_011803809.1.43180 XP_011803810.1.43180 XP_011803811.1.43180 XP_011803812.1.43180 XP_011803813.1.43180 XP_011926786.1.92194 XP_011926787.1.92194 XP_011926788.1.92194 XP_011926789.1.92194 XP_011926790.1.92194 XP_011926791.1.92194 XP_011926792.1.92194 XP_011926793.1.92194 XP_011926794.1.92194 XP_011926795.1.92194 XP_011926797.1.92194 XP_011926798.1.92194 XP_012302566.1.9421 XP_012302567.1.9421 XP_012302568.1.9421 XP_012302569.1.9421 XP_012302570.1.9421 XP_012302571.1.9421 XP_012302572.1.9421 XP_012302573.1.9421 XP_012365437.1.23891 XP_012380895.1.11602 XP_012380896.1.11602 XP_012380897.1.11602 XP_012380898.1.11602 XP_012519006.1.63892 XP_012519007.1.63892 XP_012519009.1.63892 XP_012586570.1.23501 XP_012637614.1.48125 XP_012637615.1.48125 XP_012637616.1.48125 XP_012637617.1.48125 XP_012637618.1.48125 XP_012927293.1.39548 XP_012927294.1.39548 XP_012927295.1.39548 XP_012927296.1.39548 XP_012927297.1.39548 XP_012927298.1.39548 XP_012927299.1.39548 XP_012976431.1.91757 XP_013359094.1.28644 XP_013963279.1.84170 XP_013963280.1.84170 XP_013963281.1.84170 XP_014597705.1.31192 XP_014597706.1.31192 XP_014965089.1.72884 XP_014965090.1.72884 XP_014965091.1.72884 XP_014965092.1.72884 XP_014965094.1.72884 XP_014965095.1.72884 XP_015008562.1.72884 XP_015008563.1.72884 XP_015008564.1.72884 XP_015287247.1.63531 XP_015287248.1.63531 XP_015357886.1.40921 XP_015357887.1.40921 XP_015357888.1.40921 XP_015391895.1.5354 XP_015391896.1.5354 XP_015851599.1.50099 XP_015851605.1.50099 XP_015989440.1.101085 XP_017399901.1.71028 XP_017399902.1.71028 XP_017399903.1.71028 XP_017399904.1.71028 XP_017399905.1.71028 XP_017454117.1.100692 XP_017454118.1.100692 XP_017459969.1.4139 XP_017459970.1.4139 XP_017529206.1.32401 XP_017655179.1.79516 XP_017655180.1.79516 XP_017655181.1.79516 XP_017655182.1.79516 XP_017745194.1.44346 XP_017745200.1.44346 XP_017745203.1.44346 XP_017745208.1.44346 XP_017745217.1.44346 XP_017745223.1.44346 XP_017745229.1.44346 XP_017745238.1.44346 XP_017745248.1.44346 XP_017745258.1.44346 XP_018893994.1.27298 XP_018893995.1.27298 XP_018893996.1.27298 XP_018893997.1.27298 XP_018893998.1.27298 XP_018893999.1.27298 XP_018894000.1.27298 XP_018894001.1.27298 XP_018894002.1.27298 XP_019060119.1.5607 XP_019060120.1.5607 XP_019060121.1.5607 XP_019323229.1.44245 XP_019323230.1.44245 XP_019323231.1.44245 XP_019604310.1.88060 XP_019656527.1.58354 XP_019656529.1.58354 XP_019670004.1.62641 XP_019670005.1.62641 XP_019670006.1.62641 XP_020138637.1.48125 XP_020927896.1.46622 XP_020927897.1.46622 XP_020927898.1.46622 XP_020927899.1.46622 XP_020927900.1.46622 XP_020927901.1.46622 XP_020927902.1.46622 XP_020927903.1.46622 XP_020927904.1.46622 XP_020927905.1.46622 XP_020927906.1.46622 XP_020927907.1.46622 XP_020927908.1.46622 XP_020927909.1.46622 XP_020927910.1.46622 XP_021499855.1.76796 XP_021499856.1.76796 XP_021499857.1.76796 XP_021499859.1.76796 XP_021499860.1.76796 XP_021499861.1.76796 XP_021499862.1.76796 XP_021554348.1.83697 XP_021554349.1.83697 XP_021554350.1.83697 XP_021554351.1.83697 XP_021554352.1.83697 XP_021554353.1.83697 ENSCAFP00000010378 ENSMMUP00000012077 ENSCJAP00000049262 ENSDNOP00000027804 ENSAMEP00000020222 ENSLAFP00000023786 ENSPTRP00000049808 ENSMUSP00000107048 ENSPVAP00000001497 gi|22748917|ref|NP_689650.1| gi|324021720|ref|NP_001191227.1| ENSMMUP00000012077 ENSPPYP00000005888 ENSMUSP00000107048 ENSPANP00000009118 ENSCAFP00000010378 ENSGGOP00000011685 ENSNLEP00000002807 10090.ENSMUSP00000107048 10116.ENSRNOP00000001338 9544.ENSMMUP00000012077 9598.ENSPTRP00000049808 9600.ENSPPYP00000005888 9606.ENSP00000337320 9615.ENSCAFP00000010378 9685.ENSFCAP00000010278 9823.ENSSSCP00000010427 ENSBTAP00000050069 ENSPTRP00000049808 ENSOGAP00000007840 ENSGGOP00000011685 ENSPVAP00000001497 ENSLAFP00000023786 ENSCHOP00000007057 ENSCHOP00000007057 ENSPPYP00000005888 ENSSTOP00000004974 ENSFCAP00000010278 ENSP00000337320 ENSCJAP00000049262 ENSSSCP00000010427 ENSAMEP00000020222 ENSSSCP00000010427 ENSNLEP00000002807 ENSOARP00000004883

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]