SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000050199 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000050199
Domain Number 1 Region: 1-105
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.84e-30
Family Ubiquitin-related 0.00000366
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000050199   Gene: ENSBTAG00000031582   Transcript: ENSBTAT00000044774
Sequence length 118
Comment pep:known chromosome:UMD3.1:25:28034288:28034644:-1 gene:ENSBTAG00000031582 transcript:ENSBTAT00000044774 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDVFLMIRRGKTTIFTEAKESSTVFELKRVIQGILKRPPDEQRLYKDNQLLDDSRTLGEC
GFTSQTALPQAPVTVGLAFREDEAFEDVCIEPFSSPPELPDVMKPRDSGSRANGQAVQ
Download sequence
Identical sequences E1BF97
ENSBTAP00000050199 ENSBTAP00000050199

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]